KEGG   Rhizobium sp. N731: AMK02_CH02392Help
Entry
AMK02_CH02392     CDS       T04809                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMK02_CH02392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhx02000]
    AMK02_CH02392
Enzymes [BR:rhx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AMK02_CH02392
Transporters [BR:rhx02000]
 Other Transporters
  Pores ion channels [TC:1]
   AMK02_CH02392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ANK85969
LinkDB All DBs
Position
2378941..2379567
Genome map
AA seq 208 aa AA seqDB search
MAEELVFYTNPMSRGRIARWMLEEIGQPYRTELLTFGESMKAPEYLRVNPMGKVPAIRHG
NTVVTECAAICAYLAETFPEKGLAPRPEERASYYRWMFFAAGPLESAVTMKALGFEIPTE
RLRMAGCGGFGDVMNTLEMAVSGSTYVTGERFTAADVYVGAHIGWGLGFGSIEKRQAFVD
YFGRVSERDAYKRANALDDEAGKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaactggtattctacacaaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccagccctaccgcaccgaactcctgaccttcggtgaaagcatg
aaggcgccggaatatctccgtgtcaatccgatgggcaaggtgccggcaatccgccacggc
aacaccgtggtcaccgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggccccaagaccggaggagcgcgccagctattaccgctggatgttctttgct
gccggtccactggaatcggcggtgacgatgaaggcgctcggtttcgaaattccgacggag
cgcctgcgcatggccggctgcggcggtttcggcgacgtcatgaacacgctcgaaatggcc
gtttccggctcgacttatgttaccggcgagcgcttcaccgccgccgacgtctatgtcggc
gcgcatatcggctggggcctcggcttcggttccatcgaaaaacgccaggcgttcgtcgat
tacttcggccgcgtcagcgagcgtgacgcctataagcgcgccaatgcactggacgacgag
gccggcaagacgatgcaggccgcctga

DBGET integrated database retrieval system