KEGG   Rhizobium sp. N731: AMK02_CH03173Help
Entry
AMK02_CH03173     CDS       T04809                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00240  Pyrimidine metabolism
rhx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMK02_CH03173 (tdk)
Enzymes [BR:rhx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AMK02_CH03173 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANK86722
LinkDB All DBs
Position
complement(3167381..3167983)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPDEDLFRLVMTLSGEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattatcaggagcgcggcatgcgtacggtgcagctgatcgccgccttc
gacgagcgcgccggccgcggcgtcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgaaccggacgaggatctgttccgactggtcatgacgctgagcggcgaaggggcg
ccgatctcctgcgtcttcgtcgatgaggcgcatttcatgacgcccctccatgtctggcag
cttgcccgcatcgtcgaccgactcggcatcccggtcatggtgtacgggctgaggacggat
tttcagggcaagctgtttccggcctcacaggagcttttggcgatcgccgacgaaatgcgc
gaggtgcggacgatctgccactgcgggcgtaaggcgacgatggtggtgcggctggacgcg
cagggaaaggtgctgcatgaaggggcgcagatcgatgtcggcggcaatgagaaatatgtc
tctctctgccgcaggcactgggacgacgaaatgaacggggcctggatcgccgagcctgtg
tga

DBGET integrated database retrieval system