KEGG   Rhizobium sp. N731: AMK02_PA00018Help
Entry
AMK02_PA00018     CDS       T04809                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00564  Glycerophospholipid metabolism
rhx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMK02_PA00018 (glpD)
Enzymes [BR:rhx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMK02_PA00018 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ANK87796
LinkDB All DBs
Position
pRspN731a:15883..17397
Genome map
AA seq 504 aa AA seqDB search
MGREIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATDVLDMRRDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGATIMPRTKVVS
ARRENGLWHIETTDTVTGRNDSHQARMLINAAGPWVDHVIRSAFGQNGAHHVRLVQGSHI
VVRKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLFDDGASKAQEATRDYVLKLEGEGGAAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGDFPVRGYEAEVAGLKRRYPFLADAH
ARRLVRRYGTRAVTLLGAARGLEDLGRLFGGDLYEIEVKYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAIPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatacacgacatattcgtcatcgggggcggcatcaacggctgcggcatt
gcccgcgacgccgtcgggcgcggctattccgtcgcgctggcggagatgaacgatttcgcc
tccggcacctcgtccggagccaccaagctgatccatggcggcctgcgttatctcgagcat
tatgaattccgcctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcacatcatctggccgctgcgcttcgtattgccttatcataagggcggcattcgcccc
gcctggctgatccggctcgggctcttcctttacgatcacctcggtggccgcaagctgctg
ccggcgactgatgtgctcgacatgcgcagggatccggccggcaagccgctgaaggcgctg
ttcacaagggcgttcgaatattccgacggctgggtcgacgatgcccgcatggtcgtgttg
aacgcccgcgacgctgccgacaaaggggcgacgatcatgccgcgcaccaaagtggtgtcg
gcgcggcgcgagaatggcctctggcacattgaaacgaccgatacggtcactggccgcaat
gacagccatcaggcccgcatgctgatcaatgccgccggtccctgggtcgatcatgtcatc
cgttccgccttcggccagaacggggctcatcatgtccgtctcgttcagggcagccatatc
gtcgtcaggaagaagttcgacgacccgcgtgcctatttcttccagaatcccgacaatcgc
atcatcttcgctattccctatgagggcgacttcaccctgatcggcaccaccgaccgcgac
tacaccgccgatccaaaagatgtccggatctccgaggaggagaccgtctacctctgcaac
gcggcttcggaatatttcaaggagccggtgcggcccgaggacatcgtctggacctactcg
gcagtcaggccgctttttgacgacggcgcctcgaaggcgcaggaggcgacgcgcgattat
gtgctgaagctggaaggcgagggcggggctgcgccgctgctcaacgtcttcggcggcaag
ctcaccacctatcgccggctttccgaacatgcgctggagaagatcggcgccgcgatcggc
gttaagggtgctccttggacggccaaaagccatctgcccggcggcgacttcccggtccgt
ggctacgaagcggaggtcgccggtctgaagcggcgctatccgttccttgccgatgcacac
gcccgccgactggtgcgccgctacggcacgcgggctgtgacgctgcttggcgctgcccgc
ggccttgaggacctcgggcggctgttcggcggcgatctctacgagatcgaggtcaaatat
ctcgtcgagcatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggaacaggctcagtcactggaggagtacatggctgccataccg
gcgatggccggataa

DBGET integrated database retrieval system