KEGG   Rhizobium sp. N731: AMK02_PD00179Help
Entry
AMK02_PD00179     CDS       T04809                                 

Definition
(GenBank) oligopeptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rhx  Rhizobium sp. N731
Pathway
rhx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AMK02_PD00179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhx02000]
    AMK02_PD00179
Transporters [BR:rhx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    AMK02_PD00179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_21 AAA_16 AAA_29 Sigma54_activat NACHT ATP-synt_ab AAA_7 DUF87 AAA_24 NB-ARC AIG1
Motif
Other DBs
NCBI-ProteinID: ANK88798
LinkDB All DBs
Position
pRspN731d:complement(179036..180757)
Genome map
AA seq 573 aa AA seqDB search
MTDIVPIAGRPLLEVKNLTVDFPLRTGVFRAVSDLSFAIEPGKTLCVVGESGSGKSVTAR
SILQIVDAPGRIAGGSITLNHPNGGSIDLTSLNPRGRQIRAIRGRDIAMIFQEPMSSLSP
IHTVGNQIIEALRLHTRMSKAEARAEAISLLKQVEIPAPEKALDRYAFQYSGGMRQRAMI
AMALACKPQLLIADEPTTALDVTTQAEILDLIARLQKANGMAVLFITHDMGVVAQIADDV
LVMHNGVAKEYAPVEQIFHAPKDDYTRMLIGSVLKLEQKAEIRLARAPLDRTAAPILELR
NLSMDFGEVKALDEVSISLLPGETLGIVGESGSGKTTMGRSIMRLLDPTAGEILYRRADG
GIIDLATAKGQTLAAARRELRMVFQDPFGSLNPRMTVSQIIGEPLLVNGIARGRALDERV
CHLMEQVGLDPRARERYPHAFSGGQRQRIGIARAITLNPRVIVADEATSALDVSVRSQVL
DLLMRLQDELGLAYIFISHDIGVIRYMCDRVGVMYKGQLVEIGEAEKVCRTPEHAYTQAL
ISAIPRPDPRDRDRSRRFRYVAPDTLKNGSVQR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgttcccattgccggcaggccgcttcttgaggtgaagaacctcaccgtc
gatttcccgctgcgcaccggcgtctttcgcgccgtcagcgacctgtcttttgcaatagag
ccgggcaagacgctctgcgtggtgggtgaaagcggatccggaaagtcggtgacggcgcgc
tcgatcctgcagattgtcgacgcgcccggccgcattgccggcggttcgatcacattgaac
cacccgaatggcggctccatcgatctgaccagcctcaatccgcgcgggcgccagatccgg
gcgatccgcggccgcgatatcgcgatgattttccaggagccgatgtcgtcgctgtcgccc
atccataccgtcggcaaccagatcatcgaggcgcttcgccttcacacgagaatgagcaag
gcggaagcgcgcgccgaagccatatcgctgctcaaacaggtggaaattcctgcgcctgaa
aaagcgctggatcgatacgctttccaatattccggcggcatgcgccagcgcgcgatgatc
gccatggcgctcgcctgcaagccgcaactgctgatcgccgacgagccgaccacggccctc
gacgtgacgacgcaggccgaaattctcgacctgatcgcccggctgcagaaggccaacggc
atggccgttctcttcatcacgcatgatatgggcgtcgtggcgcagatcgccgacgatgtg
cttgtgatgcacaatggcgtcgccaaggaatatgcgccggtcgagcagatctttcacgcc
ccgaaagacgactatacccgcatgttgattggttcggtgctgaagctggagcagaaggcc
gagattcgcctggcgcgagcgccgctcgatcggacggcggcgccgatcctggaattgcgc
aatctttcgatggatttcggcgaggtaaaagcactcgacgaggtctccatttcgctgctg
cccggtgagacactcggcatcgtcggcgaaagcggatctggtaagacgacgatgggccgc
tcgatcatgcggctgctcgatccaaccgccggtgaaatcctctatcgccgggctgatggt
ggtatcatcgacctggcaacggcaaaagggcagacgcttgccgccgcgcgccgcgaattg
cgcatggtgttccaggatcccttcggctccctcaatccacgcatgaccgtctcccagatc
atcggtgaacccttgctcgtcaacggcatcgcaaggggacgggcgctggacgagcgcgtc
tgccacctgatggagcaggtcggccttgatcccagggcccgcgaacgctatccgcacgcc
ttctccggcggccagcgccagcgcatcggcattgcccgcgccatcaccctcaatccgcgc
gtcatcgtcgccgatgaggcgacctcggcactcgacgtctccgtgcgctcgcaggtgctc
gatctcctgatgcgcctacaggacgaactcgggctcgcctatatctttatcagccatgac
atcggcgtcatccgctacatgtgcgaccgcgtcggcgtcatgtataagggccagctcgtc
gaaatcggcgaggcggagaaggtctgccgcacgcccgagcatgcttacacgcaagcgctg
atatcggccattccgcggccggatccacgcgaccgcgaccgttcgcggcgcttccgttat
gtcgctcccgacactctgaagaacgggagcgttcagcgatga

DBGET integrated database retrieval system