KEGG   Rhizobium sp. N731: AMK02_PD00395Help
Entry
AMK02_PD00395     CDS       T04809                                 

Gene name
dadX
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00473  D-Alanine metabolism
rhx01100  Metabolic pathways
rhx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMK02_PD00395 (dadX)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AMK02_PD00395 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhx01011]
    AMK02_PD00395 (dadX)
Enzymes [BR:rhx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AMK02_PD00395 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rhx01011]
 Precursor biosynthesis
  Racemase
   AMK02_PD00395 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANK89014
LinkDB All DBs
Position
pRspN731d:complement(423867..425000)
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSHARTAAITQGATGYLGIDLAALGRNYRKLVSMLAPVRAGAVVKADAYGLGAE
QVAKALYAQGCRHFFVAQFVEAVRLRPVLAQDAQIFVLNGLQPGNEIACADMNIVPVLNS
LAQWQQWSAAARALKRCLPAVLQFDTGMSRLGFPPEERADLATALRNGANIEVLFIMSHL
ASADETDGEQNSDQLAEMSCIADEFPGFDLSFANSGGVFLGEAYHGVLARPGIALYGGAP
TAGTVNPMEPVVSLDAAVIQTRCVSPGTKVGYGGAHVAQREMRLATIAAGYADGLPRSLS
DRGAVYYKGTRLPIVGRVSMDSITVDMSALPEGALTLGSLVEVLGPHQTLEDIARDADTI
SYEILTGLGDRYYRQYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgatattttggtttcccatgcccgtactgccgcgatcacgcagggagccaca
ggttacctcggaatcgatcttgctgcactcggccgcaattatcgcaagctggtgtcgatg
ctggccccggttcgcgcaggcgccgtcgtcaaggccgatgcctatggtctcggcgccgaa
caggtggcgaaagcgctctacgcccaaggttgccggcatttcttcgttgctcaattcgtc
gaagccgtgaggctccggccggtgcttgcgcaggacgcgcagattttcgtgctgaacggc
ctgcagccgggtaatgaaattgcctgcgccgacatgaatattgttccggttctgaattcg
ctcgcccaatggcagcaatggtcggcggcggcgcgcgcgctgaagcgctgcctgccggct
gtcctgcaattcgacaccggcatgtcgcggctgggctttcccccggaggaaagggcggat
ctggcgacagcccttcgcaatggcgccaatatcgaagtcctgttcatcatgagccatctg
gcttcggccgatgagaccgatggcgagcagaatagcgatcagctggcggaaatgtcctgc
atcgccgacgaatttccaggcttcgacctttccttcgccaattccggcggcgtcttcctc
ggcgaagcctatcatggcgtgctcgcgcggccgggcatcgccctttacgggggcgctccg
accgccggcaccgtgaacccgatggagccggtcgtcagcctcgatgcagctgtcatacag
acgcggtgcgtatcaccgggcacgaaggtcggttacggcggcgcgcatgtcgcgcaacgg
gaaatgcgtctcgccaccattgccgccggctatgccgacggcctgccgcgcagcctcagc
gaccgcggcgccgtctattacaagggtacgcgcctgccgatcgtcggccgcgtttcgatg
gacagcatcacggtcgatatgtcggcgctgcccgaaggcgcgctgacgctcggcagtctt
gtcgaagtgctcggtccgcaccagacgcttgaggatattgcgcgcgatgccgacaccata
tcttatgaaatcctgaccggtctcggcgatcggtattacaggcaatatcgctga

DBGET integrated database retrieval system