KEGG   Rhodoferax koreense: RD110_00480Help
Entry
RD110_00480       CDS       T04721                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RD110_00480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhy02000]
    RD110_00480
Enzymes [BR:rhy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RD110_00480
Transporters [BR:rhy02000]
 Other Transporters
  Pores ion channels [TC:1]
   RD110_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_2 GST_N_3 GST_N
Motif
Other DBs
NCBI-ProteinID: APW35876
UniProt: A0A1P8JQ44
LinkDB All DBs
Position
complement(103405..104013)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSAHIALHESGLAFQAIPAPTKTHQLPDGTDYYTINPLGYVPLLELDDG
TRLREGPVIVQYVADQVPLKNLAPANGTLSRYRLQEWLSFIGTELHKGFSPLFNPAMPAE
AKAIATTKLLSRYKWLNAELEGKQFLLNDHFTVADGYLFTVTTWAAKVGVDLSGFANIQA
FQARIAARPAVQEALRAESQAA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtactactcgcccggcgcctgctccctgtcggcccacatcgcgctgcatgaa
tccggcctcgccttccaggccattcccgcgcccaccaagacccaccagttgcccgacggc
accgactactacaccatcaatcccctgggctacgtaccgctgctggaactcgacgacggc
acacggctgcgcgaaggcccggtcatcgtgcagtacgtggccgaccaggtgccgctgaag
aacctcgccccggccaacggcacgctgtcgcgctaccgcctgcaggaatggctgtccttc
atcggcacggaattgcacaagggtttctcgccgctgttcaatcccgccatgccggcggaa
gccaaggccatcgccaccaccaagctgctgtcgcgctacaagtggctcaacgccgaactc
gaaggcaagcaattcctgttgaacgaccacttcaccgtggccgacggctacctgttcacc
gtgaccacctgggccgcgaaggtgggcgtggacctgtccggcttcgccaacatccaggcg
ttccaggcccgcatcgccgcccgcccggccgtccaggaagccttgcgcgcggagagccag
gctgcctga

DBGET integrated database retrieval system