KEGG   Rhodoferax koreense: RD110_01305Help
Entry
RD110_01305       CDS       T04721                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00250  Alanine, aspartate and glutamate metabolism
rhy00410  beta-Alanine metabolism
rhy00640  Propanoate metabolism
rhy00650  Butanoate metabolism
rhy01100  Metabolic pathways
rhy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RD110_01305
   00650 Butanoate metabolism
    RD110_01305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RD110_01305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RD110_01305
Enzymes [BR:rhy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RD110_01305
Amino acid related enzymes [BR:rhy01007]
 Aminotransferase (transaminase)
  Class III
   RD110_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APW36010
UniProt: A0A1P8JQJ1
LinkDB All DBs
Position
complement(282190..283458)
Genome map
AA seq 422 aa AA seqDB search
MNNQTLQQRKDAATPRGVGVMCNFYADRAENAELWDVEGRRYIDFAAGIAVLNTGHRHPK
VVAAIRAQLDRFTHTAYQIVPYASYVELAERINAITPGKHAKKTALFSTGAEAVENAVKI
ARAATGRPGVIAFGGGFHGRTMLGMALTGKVAPYKVGFGPFPSDIYHLPFPNALHGVTVD
AALKALQQLFKADIDPTRVAAVIIEPVQGEGGFYMVPPEFMRELRKVCDTHGILLIADEV
QTGFARTGRLFAMEHYDVLPDLMTLAKSLAGGMPLSAVCGRAEIMDAAQPGGLGGTYAGN
PLAVAAAHAVLDVITQEQLAERAQGLGEKLKARLHRIRKDVPQISDVRGPGGMVAVEFNR
PADGEPDVDFLKKVQSHALGHGLLLLSCGTYGNVIRFLFPLTIQDAVFDEALDILEGALR
QA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaccagaccctgcaacaacgcaaggatgccgccaccccgcgcggcgtgggcgtg
atgtgcaacttctacgccgaccgcgccgagaacgccgaactgtgggacgtggaaggccgc
cgctacatcgacttcgccgccggcatcgccgtgctcaacaccggccatcgccaccccaag
gtggtggccgcgatccgcgcccagctcgaccgcttcacccacaccgcctaccagatcgtg
ccctacgcctcttacgtggaactggccgagcgcatcaacgccatcacgcccggcaagcac
gcgaagaagacagcgttgttcagcaccggcgccgaggccgtggaaaacgccgtgaagatc
gcgcgcgccgccaccggccggccgggcgtgatcgccttcggcggcggcttccacggccgc
accatgctgggcatggcgctgacgggcaaggtggcgccctacaaggtcggcttcggccct
tttccgagcgacatctaccacctgccctttccgaacgcactgcacggcgtgacggtggat
gccgcgctcaaggcgctgcagcagttgttcaaggccgacatcgacccgacgcgggtggcc
gccgtcatcatcgagccggtgcagggcgaaggcggcttctacatggtgccgcccgaattc
atgcgcgaactgcgcaaggtgtgcgacacgcatggcatcctgctgatcgccgacgaggtg
cagaccggcttcgcacgcaccggccggctgttcgccatggagcattacgacgtgttgccc
gacctgatgacgctggccaagagcctggccggcggcatgccgctgtcggccgtgtgcggc
cgcgccgagatcatggacgcggcccagcccggcggcctgggcggcacctatgcgggcaat
ccgctggcggtggcggcggcgcatgcggtgctggatgtcatcacgcaggagcaactggcc
gagcgtgcccagggcctgggcgagaagctcaaggcgcggctccatcgcatccgcaaggac
gtgccgcagatcagcgacgtgcgcgggccgggcggcatggtcgcggtggagttcaaccgt
cccgccgacggcgaacccgacgtggatttcctgaagaaggtgcagtcgcatgcattgggc
cacggcctgctgctgctcagctgcggcacctatggcaatgtcatccgtttcctgtttcca
ttgacgatccaggacgccgtcttcgacgaggcgctggacatcctggaaggcgcgctgcgc
caggcctga

DBGET integrated database retrieval system