KEGG   Rhodoferax koreense: RD110_01375Help
Entry
RD110_01375       CDS       T04721                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00550  Peptidoglycan biosynthesis
rhy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RD110_01375
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RD110_01375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhy01011]
    RD110_01375
Enzymes [BR:rhy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RD110_01375
Peptidoglycan biosynthesis and degradation proteins [BR:rhy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   RD110_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: APW36023
UniProt: A0A1P8JQI9
LinkDB All DBs
Position
295865..298009
Genome map
AA seq 714 aa AA seqDB search
MTELKDHASELARFRLRLLVAGLVVVLAFSVVVARLVYLQVVRHEDLSEQAENNRTAIVP
VVPNRGLILDRNGVVLASNYSAYTLEITPSKVADLEQVIEELSHVVDIQPRDRRRFKKLV
EESRNFESLPIRTRLTDVEVARFTAQRYRFPGVDVKARLFRSYPYGELASHVIGYIGRIN
QNEKARIDDSEDADNYKGTEYIGKLGIEQSYEAQLHGLTGVEEIETSAGGRAVRKLASNP
ATPGNTVVMSIDIKLQKLVEDLFGDRRGALVALDPKTGEVLAFVSKPTFDPNLFVEGIDS
ESWQALNESPDKPLLNRALRGTYAPGSTYKPFMALAALETGKRTPQQSIVDPGFFMFAGH
RFRDDKEGGHGVVDMYKSIVQSCDTYYYILANDMGVDLMHDEMVKFGFGELTGIDINGEV
RGVLPSTAWKRRAYKRAEQQKWYAGETISLGIGQGYNNFTMLQLALATSVIANDGVKMKP
HLVKEVVDVVTRSSKETLREIKAEISAKPANIAVIQRALAGVTSEGTGATAFKGAGYLSA
GKTGTAQVVTIGQNEKYNANTMPERFRDNALYMAYAPAQNPQIALAMVVENAGFGGVNAA
PIARRVFDYWLMNQYPNEADLAAVQKGQAQTPLGQPRAVADVPGLPVPPMSGASAPAAVR
AGATPAQVAAAASAPASAVAMASAASMTPVPPASAASAATSAAAAARALRKSRR
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcaaggaccacgcttccgaactcgcgcgcttccggctgcgcctgctcgtc
gccggcctggtcgtggtgctggcgttttcggtggtggtggcgcggctggtctatctgcag
gtggtgcggcacgaagacctcagcgaacaggccgagaacaaccgcacggccatcgtgccg
gtggtgcccaaccgcggcctgatcctggaccgcaacggcgtggtgttggccagcaactat
tccgcctatacgctggagatcacgcccagcaaggtggccgacctcgagcaggtcatcgaa
gagctctcgcacgtggtcgacatccagccgcgggatcggcgccgcttcaagaaactcgtc
gaggaatcgcgcaacttcgagtctttgccgatccgcacccggctcaccgacgtcgaggtg
gcgcgtttcaccgcgcagcgctaccgttttccgggcgtggacgtgaaggcccggctgttc
cgcagctacccatacggcgaactcgccagccacgtgatcggctacatcggccgcatcaac
caaaacgagaaggcgcgcatcgatgactcggaggacgccgacaactacaagggcacggaa
tacatcggcaagctcggcatcgagcagagttacgaggcgcagctgcacggcctcaccggc
gtggaggagatcgagacctccgccggcggccgggcggtgcgcaaactggcgagcaatccg
gccacgccgggcaacaccgtggtcatgtcgatcgacatcaagctgcagaagctcgtggaa
gacctgttcggcgaccgccgtggtgccctcgtcgcgctcgatcccaagaccggcgaggtg
ctggccttcgtgagcaagccaaccttcgatccgaacctgttcgtcgaaggcatcgattca
gagagctggcaggcgctcaacgagtcgccggacaagccgctgctcaaccgcgccctgcgc
ggcacctatgcgccgggctcgacctacaaacccttcatggcgctggccgcgctcgagacc
ggcaagcgcacgccgcagcagagcatcgtcgaccccggcttcttcatgttcgccggccac
cgcttccgcgacgacaaggaaggcggtcacggtgtggtcgacatgtacaagtcgatcgtg
cagtcgtgcgacacctactactacatcctggccaacgacatgggcgtggacctgatgcac
gacgagatggtgaagttcggcttcggcgaactcaccggcatcgacatcaacggcgaggtg
cgaggcgtgttgccgtccaccgcctggaaacgccgcgcctacaagcgcgccgagcagcag
aagtggtacgccggcgaaaccatctcgctgggcatcggccagggctacaacaacttcacc
atgctgcagctcgcgctggccaccagcgtcatcgccaacgacggcgtgaagatgaagccg
cacctggtcaaggaggtggtggatgtggtcacgcggagctcgaaggagaccctgcgcgag
atcaaggccgagatcagcgccaaaccggccaacatcgccgtcatccagcgtgcgctggcc
ggggtgaccagcgaaggcacgggcgccacggcgttcaagggcgcgggttacctgtcggct
ggcaagaccggcacggcccaggtcgtgaccatcgggcagaacgaaaaatacaacgccaac
accatgccagagcgcttccgcgacaacgccttgtacatggcgtacgcaccggcgcagaac
ccgcagatcgcgctggccatggtggtggagaacgctggcttcggcggcgtcaatgccgcg
ccgatcgcgcgccgcgtgttcgactactggctgatgaaccaatacccgaacgaggcggat
ctggccgcggtgcagaaaggccaggcgcagacgccgctgggccagccgcgtgccgtggcc
gatgtgccgggcctgccggtgccgccgatgtccggcgcttcggcgccagcggccgtgcgg
gcgggtgccacgccggcacaagtcgccgccgcggcatccgcgcccgcatcggccgtggcc
atggcctcggcggcctcgatgacgccggtgccgccggcgtccgccgccagcgccgccacc
agcgccgccgctgccgccagggcgctgcgaaagagccggcgttag

DBGET integrated database retrieval system