KEGG   Rhodoferax koreense: RD110_06090Help
Entry
RD110_06090       CDS       T04721                                 

Definition
(GenBank) adenosylcobinamide-GDP ribazoletransferase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00860  Porphyrin and chlorophyll metabolism
rhy01100  Metabolic pathways
Module
rhy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD110_06090
Enzymes [BR:rhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     RD110_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: APW36817
UniProt: A0A1P8JST8
LinkDB All DBs
Position
complement(1280118..1280936)
Genome map
AA seq 272 aa AA seqDB search
MASFVRHYLLAIQFFTRIPVTGRLAAWVGFSPAMLRASAAHFPGVGWLVAAVCAAVAALC
LAAWPGQGFAPLVAAVLCTAAGIYMTGGFHEDGLADVADGLGGSVERARALEIMKDSRIG
AYGAMALVLALLAKVALLALLGAQADRGASALLAALCGGHVFSRWCPLVIVRSLPHVGDA
AQSKSKPLADQITNTALAIAGSWCFVPLALVFIAEGAPFLIAGMAGSLLALWWMRRLLAR
RLQGFTGDGLGATQQLCEIAFYLGAALTLRTP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcgttcggcattacctgctggccatccagttcttcacgcgcatccccgtc
acgggccggctcgcggcctgggtcggtttcagcccggccatgctgcgcgcgagcgccgcg
catttcccgggtgtgggctggctggtggccgccgtttgcgccgccgtggccgcgttgtgc
ctggcagcgtggcccggacagggctttgcgccgctggtggccgccgtgttgtgcaccgcc
gccgggatctacatgaccggcggcttccacgaggacggcctggccgacgtggccgatggc
ctgggcggcagcgtcgagcgggcgcgcgcgctagagatcatgaaggactcgcgcatcggc
gcgtacggtgcgatggcgctggtgctggccttgctggccaaggtggcgctgctggcgctg
ctcggcgcgcaggccgaccggggcgcatcggccctgctcgcggcgctgtgcggcggccat
gtgttctcgcgctggtgcccgctggtcatcgtgcgcagcctgccgcacgtgggcgacgcg
gcgcagtccaaaagcaagccactcgcggaccagatcaccaataccgcgctggccatcgcg
ggttcatggtgttttgtgcccctagcccttgtgttcattgcggagggcgctccatttttg
atagccggcatggccggcagcctgctggcgctgtggtggatgcgccgcctgctcgcacgc
cggctgcagggcttcaccggcgacggcctgggcgcgacgcagcagctctgcgagatcgcc
ttctacctcggcgcggccctgacgctgcgcacaccgtga

DBGET integrated database retrieval system