KEGG   Rhodoferax koreense: RD110_06810Help
Entry
RD110_06810       CDS       T04721                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00220  Arginine biosynthesis
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01130  Biosynthesis of antibiotics
rhy01210  2-Oxocarboxylic acid metabolism
rhy01230  Biosynthesis of amino acids
Module
rhy_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RD110_06810
Enzymes [BR:rhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     RD110_06810
    2.3.1.35  glutamate N-acetyltransferase
     RD110_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: APW36939
UniProt: A0A1P8JT61
LinkDB All DBs
Position
1450625..1451854
Genome map
AA seq 409 aa AA seqDB search
MPVHLSAPNPADLFPVAGVRLGIAEAGVRKANRKDLTVVLLDEGASVSGVFTQNRFCAAP
VQICRDHLGLGLGIRAMLINTGNANAGTGDDGLMRARSTCIALARHLNIAPEQILPFSTG
VIMEPLPTDRIEAGLTAALADAQENHWARAAEAIMTTDTVPKAFSAQVQLGGATVSITGI
SKGAGMIRPNMATMLGFMATDANIDQALMAQLAKDLADASFNRVTIDGDTSTNDSFVVIA
SNKAAHAPITSFDSEDGRALKAAMLSVAQKLAQAIVRDGEGATKFITIRVEGGQTGEECR
KVAYAIAHSPLVKTAFFASDPNLGRILAAVGYAGIDDLDQTLIDLYLDDVHVAVKGGRNP
AYREEDGQRVMKQSEITVRVVLGRGAVADTVWTCDLSHDYVTINADYRS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcatctctccgcgccgaatcccgctgacctgtttcccgtcgccggcgtgcgg
ctgggcattgccgaggccggcgtgcgcaaggccaaccggaaggatttgacggtggtgctg
ctcgacgaaggcgcgtcggtctcgggtgtgttcacgcaaaaccgcttctgcgccgcgccg
gtgcagatctgccgcgaccacctgggcttgggcctgggcatccgcgccatgttgatcaac
accggcaatgccaatgcgggcacgggcgacgacggtctgatgcgtgcgcgttcgacctgc
atcgcactcgcacgccatctgaacatcgcgcccgagcagatcctgccgttctccaccggt
gtgatcatggagccgctgccgaccgaccgcatcgaggccggcctgaccgccgcgctggcc
gatgcacaggaaaaccattgggcgcgtgcggccgaggccatcatgaccaccgacaccgtg
cccaaggcgttcagtgcacaggtacagctcggcggtgccacggtcagcatcaccggcatc
agcaagggcgcgggcatgatccggccgaacatggcgaccatgctcggcttcatggccacc
gatgccaatatcgaccaggcgttgatggcgcaactcgccaaggacttggccgacgcctcg
ttcaaccgcgtcacgatcgacggcgacacctcgaccaacgattccttcgtggtcatcgcc
agcaacaaggcggcgcatgcgcccatcacctcgttcgacagcgaagacgggcgtgcgctg
aaggccgcgatgctgtcggtggcgcagaagctcgcccaggccatcgtgcgcgacggcgag
ggcgcgaccaagttcatcacgatccgcgtcgaaggcggccagaccggcgaggaatgccgc
aaggtggcctatgccatcgcgcactcgccgctggtcaagaccgcgttcttcgccagcgac
ccgaacctcggccgcatcctggcggcggtgggttatgccggcatcgacgatctcgaccag
accctgatcgacctctacctcgacgacgtgcacgtggccgtgaagggcgggcgcaacccg
gcctaccgcgaggaagatggccagcgcgtgatgaagcaaagcgagatcacggtgcgtgtc
gtgctgggccgcggcgccgtggccgacacggtctggacctgcgacctgagccacgactac
gtgaccatcaacgcggattacaggtcttaa

DBGET integrated database retrieval system