KEGG   Rhodoferax koreense: RD110_07180Help
Entry
RD110_07180       CDS       T04721                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00020  Citrate cycle (TCA cycle)
rhy00190  Oxidative phosphorylation
rhy00650  Butanoate metabolism
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01120  Microbial metabolism in diverse environments
rhy01130  Biosynthesis of antibiotics
rhy01200  Carbon metabolism
Module
rhy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rhy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD110_07180 (sdhB)
   00650 Butanoate metabolism
    RD110_07180 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RD110_07180 (sdhB)
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RD110_07180 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     RD110_07180 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: APW37010
UniProt: A0A1P8JTE7
LinkDB All DBs
Position
complement(1527211..1527915)
Genome map
AA seq 234 aa AA seqDB search
MTKRTFQIYRYDPDTDAKPYMQTIEIELDGHERMLLDALVKLKKQDPTLSFRRSCREGVC
GSDAMNINGKNGLACLTNMNTLPGVVVLKPLPGLPVIRDLIVDMTQFFKQYNSIKPYLIS
DTPAPERERLQSPEEREELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDDATAERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKEMMVLRTI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacgcaccttccagatctaccgctacgacccggacaccgacgccaagccgtac
atgcagaccatcgagatcgaactcgacggccatgaacgcatgctgctcgacgccctggtc
aagctgaagaaacaggaccccacgctgtcgttccgccgctcctgccgcgaaggcgtgtgc
ggctccgacgcgatgaacatcaatggcaagaacggcctggcctgcctgaccaacatgaac
acgctgcccggcgtggtggtgctgaagccgctgcccggcctgccggtcatccgcgacctg
atcgtggacatgacccagttcttcaagcagtacaactcgatcaagccgtacctgatcagc
gacacgccggcccccgagcgcgagcggctgcaaagccccgaggagcgcgaggagctcaac
ggcctgtacgaatgcatcctgtgcgcgagctgctccacgagctgcccgagcttctggtgg
aaccccgacaagttcgtcggcccggccggtctgctgcaggcctaccgcttcatcgccgac
agccgcgacgacgccaccgccgagcgcctggacaacctggaagatccgtaccgcctgttc
cgctgccacaccatcatgaattgcgtcgacgtctgccccaagggcctgaacccgaccaag
gcgatcggcaagatcaaggagatgatggttttgcgcaccatctga

DBGET integrated database retrieval system