KEGG   Rhodoferax koreense: RD110_07185Help
Entry
RD110_07185       CDS       T04721                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00020  Citrate cycle (TCA cycle)
rhy00190  Oxidative phosphorylation
rhy00650  Butanoate metabolism
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01120  Microbial metabolism in diverse environments
rhy01130  Biosynthesis of antibiotics
rhy01200  Carbon metabolism
Module
rhy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rhy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD110_07185
   00650 Butanoate metabolism
    RD110_07185
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RD110_07185
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RD110_07185
    1.3.5.4  fumarate reductase (quinol)
     RD110_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA HI0933_like Pyr_redox_3 Lycopene_cycl SPESP1 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: APW37011
UniProt: A0A1P8JTH9
LinkDB All DBs
Position
complement(1527966..1529774)
Genome map
AA seq 602 aa AA seqDB search
MSYTKANITKRKFDVVIIGAGGSGMRAALELSRAGLNVASLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQQNVKAKTNFFVEWMALDLIRDADG
DVVGVTALEMETGDLHILQAKTVLLATGGAGRIFGASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILRNADGERFMERYAPTLKDLAPRDFVSRCMDQ
EIKEGRGCGPNKDYIVLDMTHLGVETIAKRLPSVLEIGHNFANVDITKEPIPVVPTIHYQ
MGGIPTNINGQVITQKDGIDNAVVNGLYAVGECACVSVHGANRLGTNSLLDLLVFGKAAG
RHIVEFNNRNKEHKPLPADAADKTLARLNQLDSSTDGTYSQDIAGDIRAAMQLHAGVFRT
QASMDEGVKKIAEIRSRVASVTLKDKSKVFNTARIEALEVDNLIEVAQATMVSAAARREC
RGAHTVYDYEHPADHAEFPLGRNDKEWMKHTLWYSEGNRLAYKPVNLKPLTVDSVPPKVR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaccaaagccaacatcaccaagcgcaagttcgacgtcgtcatcatcggcgcc
ggcggctccggcatgcgcgccgccctcgaactgtcccgcgccggcctcaacgtggcctcg
ctgtccaaagtgtttcccacccgcagccacaccgtggccgcgcaaggcggcgtctccgcc
tcgctgggcaacatgtccgaagacaactggcactaccacttctacgacaccatcaagggc
tccgactggctcggcgaccaggacgcgatcgaattcatgtgccgcgaagccccgaaggtg
gtctatgaactggaacacttcggcatgccgttcgaccgcaaccccgacggcacgatctac
cagcgcccgttcggcggccacaccgccaactacggcgagaaacccgtgcagcgcgcctgc
gccgcggcagaccgcaccggccacgccatgctgcacacgctgtaccagcagaacgtcaag
gccaagaccaacttcttcgtcgaatggatggcgttggacctgatccgcgacgccgacggc
gacgtggtcggcgtgaccgctctcgagatggaaaccggcgacctgcacatcctgcaggcc
aagaccgtgctgctggccaccggtggtgccggccgcatcttcggcgcatcgaccaacgcc
ttcatcaacaccggcgacggcctgggcatggcggcacgctcgggcatcgcgctgcaggac
atggagttctggcagttccaccccaccggcgtcgccggcgccggcgtgctgctgaccgaa
ggctgccgcggcgaaggcgcgatcctgcgcaacgccgatggcgaacgcttcatggagcgt
tatgcgcccacgctgaaggatctggcaccgcgcgacttcgtctcgcgttgcatggaccag
gaaatcaaggaaggccgcggctgcggtccgaacaaggactacatcgtcctggacatgacc
cacctgggcgtggagaccatcgccaagcgcctgcccagcgtgctggagatcggccacaac
ttcgccaacgtcgacatcaccaaggagccgatcccggtggtgcccacgatccattaccag
atgggcggcatcccgaccaacatcaacggccaggtcatcacccagaaggacggtatcgac
aacgccgtcgtcaacggcctctacgccgtgggcgagtgcgcctgcgtgagcgtgcacggc
gcgaaccgcctgggcacgaactcgctgctcgacctgctggtgttcggcaaggccgccggc
cgccacatcgtcgaattcaacaaccgcaacaaggagcacaagcctctgccggcggatgcg
gccgacaagaccctggcgcgcctgaaccagttggacagctcgaccgacggcacgtattcg
caggacatcgccggcgacatccgcgccgcgatgcaactgcacgccggcgtgttccgcacc
caggccagcatggacgaaggcgtgaagaagatcgccgagatccgcagccgcgtggccagc
gtcacgctgaaggacaagtccaaggtgttcaacaccgcgcgcatcgaggcgctcgaggtc
gacaacctgatcgaagtggcgcaggccacgatggtctcggccgcggcgcgccgcgaatgc
cgtggcgcccacacggtgtacgactacgaacacccggccgaccatgcggaattcccgctc
ggccgcaacgacaaggagtggatgaagcacacgctgtggtacagcgaggggaaccggctg
gcctacaagccggtcaacctcaagccgctcacggtggacagcgtgccgccgaaggtccgt
accttctga

DBGET integrated database retrieval system