KEGG   Rhodoferax koreense: RD110_12040Help
Entry
RD110_12040       CDS       T04721                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
rhy  Rhodoferax koreense
Pathway
rhy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RD110_12040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhy02000]
    RD110_12040
Transporters [BR:rhy02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter
    RD110_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N ABC_ATPase AAA_23 RsgA_GTPase AAA_25 AAA_30 AAA_15 MMR_HSR1 APS_kinase AAA_27
Motif
Other DBs
NCBI-ProteinID: APW37840
UniProt: A0A1P8JVQ5
LinkDB All DBs
Position
complement(2545815..2547356)
Genome map
AA seq 513 aa AA seqDB search
MNRGISLDTILEMHDIRKTFPGVVALNKVNLRVRAGEIHALVGENGAGKSTLMKVLSGVY
PHGEYSGEIHYLGQAQRFGGIHDSERQGIIIIHQELALVPLLSIAENIFLGNETARHGVI
DWMEAHSQTQALLKKVGLKESPDTLITNIGVGKQQLVEIAKALSKKVKLLILDEPTASLN
ETDSDALLMLLLELKAQGIACILISHKLNEIAKVADAITILRDGSTVETLDCRAQAISED
RVIRGMVGRDMADRYPKRTPQIGETVFELRGWRAFHPQHAEREVVKGIDLTVRRGEIVGI
AGLMGAGRTELAMSVFGRSWGQRISGQALLHGQEIDVSTVQKAVAHGLAYVTEDRKGNGL
VLSEDIQWNTSLANLPGVSHRGVIDDGREFAVAEGFRKKMRTRCSGVDQKVVNLSGGNQQ
KVVLSKWLFTNPEVLILDEPTRGIDVGAKFEIYTLIAQLAAEGKCVIVISSEMPELLGLS
DRIYVMNEGRFVAEMPVADASQEKIMRAIVGAK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaggaatatcgttggacaccatcctggagatgcacgacatccgcaagaccttc
cccggcgtggtggcgctgaacaaggtgaacctgcgggtgcgtgcgggtgaaatccatgcg
ctggtgggcgagaacggcgcgggcaagtcgacgctgatgaaagtgctgtcgggcgtgtac
ccgcacggcgaatacagtggcgaaatccactacctcgggcaggcgcagcgcttcggtggc
atccacgacagcgaacggcagggcatcatcatcatccaccaggagttggccctggtgccg
ctgctgtcgatcgccgagaacatcttcctcggcaacgagaccgcgcgccatggcgtgatc
gactggatggaggcgcacagccagacccaggccttgctgaagaaggtcgggttgaaggaa
tcgcccgacacgctcatcaccaacatcggcgtgggcaagcagcaactggtggagatcgcc
aaggcgctgtcgaagaaggtgaagctgctgatcctcgacgagcccacggccagcctgaac
gaaaccgacagcgacgcgttgttgatgctgctgctggaactcaaggcccagggcatcgcc
tgcatcctgatctcgcacaagctcaacgagattgccaaggtggccgacgccatcaccatc
ctgcgcgatggcagcacggtggagacgctggactgccgcgcgcaggccatcagcgaagac
cgcgtgatccgcggcatggtgggccgcgacatggccgaccgttacccgaagcgcacgccg
cagatcggcgagacggtgttcgagctgcgcggctggcgcgccttccatccgcagcacgcc
gagcgcgaagtcgtcaagggcatcgacctcacggtccggcgcggcgagatcgtcggtatc
gccggactcatgggcgcgggccgcaccgagctggcgatgagcgtcttcggccgatcatgg
ggccagcgcatcagcggccaggccctgctgcacggccaggaaatcgacgtctccacggtg
cagaaagccgtggcccacggcctggcctatgtgacggaagaccgcaagggcaacggcctg
gtcctgagcgaagacattcagtggaacacctcgctggcgaacctgcccggcgtgtcccac
cggggtgtgatcgacgatggccgcgagttcgcggtggccgagggcttccgcaagaagatg
cgcacgcgctgctccggcgtggaccagaaggtggtcaacctttccggcggcaaccagcag
aaggtggtgctgagcaaatggctgttcaccaaccccgaggtgctgatcctggacgaaccc
acccgcggcatcgacgtgggggcgaagttcgagatctacacgctgatcgcgcagctggcc
gccgaaggcaagtgcgtgatcgtgatctcgtcggagatgccggagctgctgggcctgtcg
gaccgcatttatgtgatgaacgaagggcgcttcgtggccgagatgccggtcgccgacgcc
agccaggaaaagatcatgcgcgccatcgtcggcgccaagtga

DBGET integrated database retrieval system