KEGG   Rhodoferax koreense: RD110_14935Help
Entry
RD110_14935       CDS       T04721                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00010  Glycolysis / Gluconeogenesis
rhy00620  Pyruvate metabolism
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD110_14935
   00620 Pyruvate metabolism
    RD110_14935
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RD110_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APW38325
UniProt: A0A1P8JX59
LinkDB All DBs
Position
3227638..3229158
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGKFGTAVHFKKRYGNYIGGEWVAPVDGQYFENVTPITGKPFCEIPRSTAADIDR
ALDAAHKAKTAWGKTSTTDRANILNKIADRMQDNLPMLAAAETWDNGKPIRETTLADLPL
AIDHFRYFASCIRAQEGGISEIDHETYAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALA
AGNCVVLKPAEQTPVSILVLMEVIGDLLPPGVLNVVNGFGVEAGKPLASSNRIAKIAFTG
ETTTGRLISQYASQNLIPVTLELGGKSPNIFFADVLDQDDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIKQGSPLDMATMIGAQASSEQLEKILSYMDIGR
QEGAQVLIGGERSRLEGDLAEGYYIQPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWSRNMNTAFRMGRGIQAGRVWTNCYHQYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSENKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgttggaacccggcaaattcggcacggcagtgcacttcaagaagcgttacggc
aactacatcggcggcgaatgggtcgcgccggtggacggccagtatttcgagaacgtgacg
cccatcaccggcaagcccttttgcgagatcccgcgctcgacggccgccgacatcgaccgc
gcgctcgacgcggcgcacaaggccaagacggcctggggcaagacctcgaccacggaccgc
gccaacatcctgaacaagatcgccgaccgcatgcaggacaacttgccgatgctggccgcc
gccgagacctgggacaacggcaagccgatccgcgagacgacgctggccgacctgccgctc
gcgatcgaccatttccgctacttcgcgtcctgcatccgcgcgcaggaaggtggcatcagc
gagatcgaccacgagacctatgcctaccacttccacgagccgctgggcgtggtcgggcag
atcatcccctggaacttccccttgctgatggcggtgtggaagctcgcgccggcgctggcc
gcgggcaactgcgtggtgctcaagcccgccgagcagacgccggtgtcgatcctggtgctg
atggaagtcatcggcgacctgctgccgccgggcgtgctcaacgtggtcaacggtttcggc
gtggaagccggcaagccgctggcctcgagcaaccgcatcgccaagatcgccttcaccggc
gagaccaccaccggccggctgatctcgcagtacgcgagccagaacctgatcccggtgacg
ctggagctcggcggcaagtcgcccaacatcttcttcgccgacgtgctcgaccaggacgac
gccttcttcgacaaggcgctcgaaggcttcgccatgttcgcgctcaaccagggcgaggtc
tgcacctgcccctcgcgcgcgctgatccaggaatcgatctacgaccgcttcatggaacgt
gccctgaagcgcgtggccgccatcaagcaaggcagcccgctcgacatggcgaccatgatc
ggcgcgcaggcttcgagcgaacagctcgagaagatcctgtcgtacatggacatcggccgc
caggaaggcgcgcaggtgctgatcggcggcgaacgcagccggctcgaaggcgacctggcc
gagggttactacatccagcccacggtgttcaagggccacaacaagatgcgcgtgttccag
gaagagatcttcggccccgtggtctcggtcaccaccttcaaggacgaggaagaggccctg
gccatcgccaacgacacgctctacggcctgggcgcgggcgtgtggagccgcaacatgaac
accgccttccgcatgggccgcggcatccaggccggacgcgtgtggaccaactgctaccac
cagtacccggcgcatgcggccttcggcggctacaagcagtcgggcatcggccgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcgag
aacaagctcggtttcttctga

DBGET integrated database retrieval system