KEGG   Rhodoferax koreense: RD110_14940Help
Entry
RD110_14940       CDS       T04721                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00010  Glycolysis / Gluconeogenesis
rhy00071  Fatty acid degradation
rhy00350  Tyrosine metabolism
rhy00625  Chloroalkane and chloroalkene degradation
rhy00626  Naphthalene degradation
rhy01100  Metabolic pathways
rhy01110  Biosynthesis of secondary metabolites
rhy01120  Microbial metabolism in diverse environments
rhy01130  Biosynthesis of antibiotics
rhy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD110_14940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RD110_14940
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RD110_14940
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RD110_14940
   00626 Naphthalene degradation
    RD110_14940
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RD110_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: APW38326
UniProt: A0A1P8JX46
LinkDB All DBs
Position
3229253..3230287
Genome map
AA seq 344 aa AA seqDB search
MIPRTMKAAVVRAFGQPLRIEEVPVPQASDDQILVKIEASGVCHTDLHAAEGDWPVKPSP
PFIPGHEGVGFVAAVGRNVKHVKEGDRVGVPWLHSACGHCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPDYVGHLPKDIGFVEIAPVLCAGVTVYKGLKMTDTRPGDWVVISGIGG
LGHMAVQYARAMGLNVAAVDVEDDKLALARELGATVTVNARTTDPAAYLQKQIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVTLNGLPPGNFPLPIFDMVLRGVTVRGSIVGSRLDLQES
LDFAARGQVRATVATERLENINEVFARMHKGQIQGRIVIDMSAG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattccaagaaccatgaaggccgccgtcgtccgcgcgttcggccagccgctgcgcatc
gaggaagtgccggtgccccaagcctcggacgaccagatcctcgtgaagatcgaggcctcc
ggcgtgtgccataccgacctgcacgccgccgagggcgactggccggtcaagccgagcccg
ccgttcattcccggccatgaaggcgtgggcttcgtcgccgcggtgggccgcaacgtcaaa
cacgtaaaggaaggcgaccgcgtgggtgtgccctggctgcattcggcctgcggacactgc
acccactgcctgggcggctgggagacgctgtgcgaatcgcagagcaacaccggctattcg
gtcaacggcggcttcgccgactatgcgctggccgaccccgattacgtgggccacctgccg
aaggacatcggtttcgtcgagatcgccccggtgctgtgcgccggcgtcacggtctacaag
ggcctgaagatgaccgacacgcgcccaggcgactgggtggtgatctcgggcatcggcggc
ctgggccacatggccgtgcagtacgcccgtgccatgggcctgaacgtggccgcggtggac
gtggaagacgacaagctcgcgctggcccgggaactgggtgccaccgtcacggtgaacgcc
cggacgaccgaccccgccgcctacctgcagaagcagattggcggcgcgcacggcgcgctg
gtcacggccgtctcgcccaaggccttcgaacaggcgttgggcatggtgcggcgcggcggc
acggtcacgctcaacggcttgccgccgggcaacttcccgctgccgatcttcgacatggtg
ctgcgcggcgtgacggtgcgtggctccatcgtgggctcgcggctggacctgcaggagtcg
ctggacttcgcggcgcgcggccaggtgcgcgccacggtcgccaccgaacgcctggagaac
atcaacgaagtgttcgcgcgcatgcacaagggccagatccagggccgcatcgtgatcgac
atgtcggcgggctga

DBGET integrated database retrieval system