KEGG   Rhodoferax koreense: RD110_21255Help
Entry
RD110_21255       CDS       T04721                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhy  Rhodoferax koreense
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RD110_21255
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RD110_21255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin AlaDh_PNT_C HI0933_like FAD_binding_3 DAO K_oxygenase FMO-like Thi4 Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APW39429
UniProt: A0A1P8K099
LinkDB All DBs
Position
4577338..4578939
Genome map
AA seq 533 aa AA seqDB search
MLDTATKAQLKSYLERATQPIEIVASVDDSKASGEVLSLLKDVAESSPLVKLTESRDDPH
RKPSFSVNRPGENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQAILDQIKALDGDFD
FEIYVSLTCHNCPDVVQALNLMAVQNPRIRATMIEGGTFQDEVKERQIMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEREAKKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTMGIENFISVKETEGPKFAHALEEHVRNYDVDIMNLQRAAALVPGKDLI
EIKLENGASLKSRSVIISTGARWRNINVPGEQEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLVEFDTQLRADAVLQRKLTSLANVTVIKNAQTTEITGDQKV
NGLVYKDRGTAELHTVPLEGVFIQIGLVPNTDWLKGVVELTKHGEIVVDARGQTSVPGVF
AAGDATTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPAEAPIELVKALAEATA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccgccaccaaagcccaactgaagagttacctcgaacgtgccacgcagccg
atcgaaatcgtcgcctcggtcgacgacagcaaggcctcgggcgaagtgctgtcgctgctg
aaggacgtggccgagtcgtccccgctggtcaagctgaccgagagccgcgacgatccgcac
cgcaaaccctcgttctccgtcaaccgccccggtgaaaaccacggaccgcgtttcgccggc
ctgccgatgggccacgaattcacgtcgctgatcctcgcgctgctgcagatcggcggctat
ccacccaaggtcgaacaggccatcctcgaccagatcaaggcgctcgacggtgatttcgac
ttcgagatctatgtctcgctgacctgccacaactgccccgacgtcgtgcaggcgctgaac
ctgatggcggtgcagaacccgcgcatccgcgccacgatgatcgaaggcggcaccttccag
gacgaagtcaaggaacgccagatcatggccgtgccgaccgtgttcctcaacggcaccgaa
ttcggccagggccgcatgagcctggaggaaatcctggccaagatcgacaccagcggtgtc
gagcgcgaagccaagaagatcgccgccaaggacccgttcgacgtgctgatcgtcggcggt
ggccccgctggtgccgcagccgccgtgtacgccgcacgcaagggcatccgtaccggcgtg
gcgtccgagcgtttcggcggccaggtgctcgacaccatgggcatcgagaacttcatctcg
gtgaaggaaaccgaagggccgaagttcgcccacgcgctggaagagcacgtgcgcaactac
gacgtcgacatcatgaacctgcagcgtgcggccgcgctcgtgcccggcaaggacctgatc
gagatcaagctggaaaacggcgcctcgctgaagagccgttcggtgatcatctccaccggc
gcgcgctggcgcaacatcaacgtgcccggcgagcaggagttcaagaacaagggcgtggcc
tattgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatcggcggc
ggcaactcgggcgtggaagcggcgatcgacctggccggcatcgtcggccatgtgacgctg
gtcgagttcgacacgcagctgcgcgccgatgccgtgctgcagcgcaagctcaccagcctg
gccaacgtgaccgtgatcaagaatgcgcagaccaccgagatcaccggcgaccagaaggtc
aacggcctggtctacaaggaccgcggcaccgctgaactccacaccgtgccgctcgaaggc
gtgttcatccagatcggcctggtgcccaacaccgactggctcaagggtgtggtcgagctg
acgaaacacggcgagatcgtggtcgatgcacgcggccagacctcggtgcccggcgtgttc
gccgcaggcgatgcgaccaccgtgccgttcaagcagatcatcatcgccgccggtgatggc
gccaaggccgcgctcggcgctttcgaccacctgatccgcacctcggcacccgccgaagcg
ccgatcgaactggtgaaggcattggccgaagccacggcctga

DBGET integrated database retrieval system