KEGG   Rhodoferax koreense: RD110_24035Help
Entry
RD110_24035       CDS       T04721                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00473  D-Alanine metabolism
rhy00550  Peptidoglycan biosynthesis
rhy01100  Metabolic pathways
rhy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RD110_24035
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RD110_24035
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RD110_24035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhy01011]
    RD110_24035
Enzymes [BR:rhy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RD110_24035
Peptidoglycan biosynthesis and degradation proteins [BR:rhy01011]
 Precursor biosynthesis
  Amino acid ligase
   RD110_24035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK CPSase_L_D2 TTL GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: APW39896
UniProt: A0A1P8K1M8
LinkDB All DBs
Position
complement(5193052..5194035)
Genome map
AA seq 327 aa AA seqDB search
MSATGQNHSNLGKVAVLMGGASAEREVSLMSGTGVLAALRSQGVDAHAFDPAERDLVELK
REGFARCFIALHGRFGEDGTVQGALELLGIPYTGSGVMASSIAIDKIMTKRVWIAEGVPT
PKYRLLAQGSIDRRQVIEVPDELGLPVIVKPAREGSSIGVNKVEGYSGMVEAVDAVLRLD
SQVLCEAFIEGDEVTCPVLGTGDEAQALPVIRIVAPEGNYDYQNKYFTDTTQYLVPCGLP
AGEEEAIQALVLKAYRVLGCRGWGRIDVMIDKATRKPYLLEINTSPGMTSHSLVPMSARA
AGLSYEALCLRLLQAAALDNAPGAPQP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctacaggccaaaatcattcaaatctgggtaaggttgccgtactcatgggcggc
gcttcggccgagcgcgaggtgtcgctgatgtcgggcaccggcgtgctggccgcactgcgc
agccagggggtggacgcgcatgcgttcgacccggccgagcgggatctggtcgagctcaag
cgcgagggcttcgcgcgctgtttcatcgcgctgcacggccgcttcggcgaggacggcacg
gtgcagggtgcgcttgaactgctgggcattccctacaccggctcgggcgtgatggcgtcg
agcatcgccatcgacaagatcatgaccaagcgggtctggatcgccgagggcgtgccgacg
ccgaaataccgcctgctcgcccagggcagcatcgaccggcgccaggtgatcgaggtgccg
gacgagctcggcctgccggtgatcgtcaagccggcgcgcgaaggttcttccatcggcgtg
aacaaggtcgagggctactcgggcatggtggaagcggtggacgccgtgctgcgcctcgat
tcgcaggtgctgtgcgaggcgttcatcgaaggcgacgaggtgacctgcccggtgctgggc
accggggacgaggcgcaggccctgccggtgatccgcatcgtcgcgcccgaaggcaactac
gactaccagaacaagtacttcaccgacaccacgcagtacctggtgccctgcggcctgccc
gccggcgaagaggaggcgatccaggctctggtgctcaaggcctaccgcgtgctcggctgc
cgcggctgggggcgcatcgacgtgatgatcgacaaggccacgcgcaagccctacctgctg
gagatcaacacctcgcccggcatgaccagccattcgctggtgccgatgtcggcccgtgcc
gccggcctgtcgtacgaagccctgtgcctgcggctcttgcaggccgcggcgctggacaac
gcaccgggagcgcctcagccatga

DBGET integrated database retrieval system