KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_05020Help
Entry
RHPLAN_05020      CDS       T04290                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00020  Citrate cycle (TCA cycle)
rhz00310  Lysine degradation
rhz00380  Tryptophan metabolism
rhz01100  Metabolic pathways
rhz01110  Biosynthesis of secondary metabolites
rhz01120  Microbial metabolism in diverse environments
rhz01130  Biosynthesis of antibiotics
rhz01200  Carbon metabolism
Module
rhz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHPLAN_05020
  09105 Amino acid metabolism
   00310 Lysine degradation
    RHPLAN_05020
   00380 Tryptophan metabolism
    RHPLAN_05020
Enzymes [BR:rhz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RHPLAN_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMN38967
UniProt: A0A140GVD7
LinkDB All DBs
Position
553257..556211
Genome map
AA seq 984 aa AA seqDB search
MSRQDANAAFARTSFLYGGNAAYVEQLQSRYEANPASVDAEWRAFFESLKDEREDVRKNA
SGPSWQRPITHANGELVAALTGDWAEVEKTIGDKVKAKAQSKGVEISAADVQQATRDSIR
ALMLIRAYRIRGHFHAKLDPLGLEPEKSEEELDPRSYGFTEADFDRKIFIDKVLGLEFAN
LREILAIVRRTYCQTLGVEFMHISDPAQKAWLQERIEGRDKEINFTREGKRAILNKLVEA
EGFEKFCDIKFTGTKRFGLDGGESMIPALEQIIKRGGALGVKEIVIGMAHRGRLNVLAQV
MGKPHRAIFHEFKGGSSSPDSVEGSGDVKYHLGASSDREFDGNQVHLSLTANPSHLEIVN
PVVLGKTRAKQDQHGASREDRTMVMPLLISGDAAFAGQGVIAECFGLSGLRGHRTGGSVH
FIVNNQIGFTTYPRFSRSSPYPSDVAKMIEAPIFHANGDDPEAVVYAAKVATEFRQKFQV
PVVVDMFCYRRFGHNEGDEPAFTQPVMYKAIRSHPSTLDIYAKRLVGENVVTDGEVEKMR
ADWRARLDVEQEASQSYKANHADWLDGRWSGMKAAASVSDDPRRGNTGVAVETLKDIGSK
ITKVPEGFHVHRTIQRFLDARQKAIETGQGIDWATAEALAFCSLLLDGHPVRLSGQDSER
GTFSSRHSVLIDQENEDRYTPFNEIGQKQARYEVINSMLSEEAVLGFEYGYSLAEPNALT
LWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERYLQM
CAEDNMQVANCSTPSNYFHILRRQLKREIRKPLILMTPKSLLRHKRAVSRLDEMATGTTF
HRVLWDDAQMLPDEKIKLVEDSKIRRVVMCTGKVYYDLYEEREKRGIDDIYLLRVEQLYP
FPTKALVTELARFKQAEFVWCQEEPRNMGAWHFVEHYIEWVLNQIEAKQRRPRYATRPAS
AATAVGQMSKHQAQLKQLLDEALG
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgccaagatgcgaatgcggcgttcgcccgcacgtcatttctctatggcggcaat
gccgcctatgtcgaacaactccaatcccgctatgaagccaatccggcgtcggtcgacgcc
gaatggcgcgccttcttcgagagtctgaaggacgagcgcgaggacgttcgcaagaacgcc
agcggtccctcgtggcagcggccgatcacccacgccaacggcgaactggtcgcggctctc
accggcgactgggccgaggtcgagaagaccatcggcgacaaggtcaaggccaaggcgcag
agcaagggcgtcgagatttcggccgccgacgtgcagcaggcgacgcgcgattcgatccgc
gcgctcatgctgatccgcgcctaccgcatccgcggccacttccacgccaagctcgatccg
ctcggccttgagcccgagaagagcgaagaggagctcgatccgcgctcctacgggttcacc
gaagccgacttcgaccgcaagatcttcatcgacaaggtgctcggcctggaattcgccaac
ctgcgcgaaatccttgccatcgtgcgccgcacttactgccagacgctaggcgtcgagttc
atgcacatctccgatcccgcgcagaaggcgtggctgcaggagcgcatcgagggccgcgac
aaggagatcaacttcacccgcgagggcaagcgcgcgatcctcaacaagctggtcgaagct
gaaggcttcgagaagttctgcgatatcaagttcaccggcaccaagcgcttcggcctcgac
ggcggcgagtcgatgatcccggcgctggagcagatcatcaagcgcggcggcgcgcttggc
gtcaaagagatcgtcatcggcatggcccatcgcggccggctcaacgtgctggcccaggtg
atgggcaagccgcaccgcgcgatcttccatgagttcaagggcggctcgtcgtcaccggac
agtgtcgaaggctcgggcgacgtgaagtatcacctcggcgcctcgtcggaccgtgagttc
gacggcaaccaggtgcatctgtcgctcaccgcgaacccgtcgcatctcgagatcgtcaat
ccggtggtgctgggcaagacccgcgccaagcaggatcagcacggcgcgagccgcgaagac
cgcaccatggtgatgccgctgctcatctccggcgacgccgcgttcgcgggccagggcgtg
atcgccgaatgcttcggcctctcgggcctgcgcggccatcgcaccggcggttcggtgcat
ttcatcgtcaacaaccagatcggcttcacgacctatccgcgcttctcgcgttcgtcgccg
tatccgtccgacgtcgccaagatgatcgaggcgccgatcttccacgccaacggcgacgat
cccgaagctgtggtctacgccgccaaggtcgcgaccgaattccggcagaagttccaggtg
ccggtcgtggtcgacatgttctgctaccgccgcttcggccacaacgagggcgacgagccg
gcattcacgcagccagtgatgtacaaggcaatccgctcgcatccttcgacgctggacatc
tacgccaagcgcctcgtcggcgagaatgtcgtcaccgacggcgaagtcgagaagatgcgc
gccgactggcgcgcccggctcgacgtcgagcaggaggcgagccagagctacaaggccaac
cacgccgactggctggacggtcgctggtccgggatgaaggccgccgcgtccgtcagcgac
gatccgcgccgtggcaacaccggcgtcgccgtcgagaccttgaaggacatcggcagcaag
atcaccaaggtgccggagggcttccacgtccaccgcaccattcagcgcttcctcgacgcg
cgccagaaggcgatcgaaaccgggcagggcatcgactgggccaccgccgaggcgctggcc
ttctgctcgctgctgctcgacggccatccggtgcggctgtccggacaggactccgagcgc
ggcaccttctcgtcgcggcactccgtcctgatcgaccaggagaatgaggaccgctacacg
ccgttcaacgagatcggccagaagcaggcgcgctacgaggtcatcaactcgatgctctcg
gaggaggccgtgctcggcttcgaatacggctattcgctcgccgagcccaatgcgctcacc
ctgtgggaggcgcagttcggcgatttcgccaacggcgcccaggtggtgttcgatcagttc
atctcgtcgggcgaacgcaagtggctgcgcatgtcgggcctcgtctgcctgctgccgcac
ggctatgaaggccaggggcccgagcactcctccgcgcgcctcgagcgctatctgcagatg
tgcgccgaggacaacatgcaggtcgccaactgctcgacgccgtcgaactacttccacatc
ctgcgccgtcagctgaagcgcgagatcagaaagccactgatcctcatgacgccgaagtcg
ctgctccgtcacaagcgggcggtatcgcggctcgatgagatggccaccggcaccacgttc
caccgcgtgctgtgggacgatgcgcaaatgctgccggacgagaagatcaagctggtcgag
gacagcaagatccgccgcgtcgtgatgtgcaccggcaaggtctattacgatctctacgag
gagcgcgagaagcgcggcattgacgacatctatctgctgcgcgtcgaacagctctatccg
ttcccgaccaaggcgctggtcaccgagctcgcccgcttcaagcaggccgagttcgtctgg
tgccaggaggagccgcgcaacatgggcgcgtggcacttcgtcgagcactacatcgaatgg
gtgctgaaccagatcgaggccaagcagaggcggccgcgctacgcgacgcgtccggcttcg
gccgcgaccgcggtcggccagatgtcgaagcatcaggcgcagttgaagcagctcctcgac
gaggcgctgggataa

DBGET integrated database retrieval system