KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_07860Help
Entry
RHPLAN_07860      CDS       T04290                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RHPLAN_07860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhz02000]
    RHPLAN_07860
Enzymes [BR:rhz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RHPLAN_07860
Transporters [BR:rhz02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHPLAN_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin GST_C_5 GST_N_4 Tom37 GST_N_5
Motif
Other DBs
NCBI-ProteinID: AMN39248
UniProt: A0A127EPQ1
LinkDB All DBs
Position
903098..903793
Genome map
AA seq 231 aa AA seqDB search
MAKYLLVSFKTCPWVQRAAIVLREKGVDFEFRHIDRDNRPDWFLAISPHKKVPVLSVDGK
VSLFESNAIAEYLDETIAPRLHPEDPVQRAVNRAWTDFLPTFADMVTGQAYSEDEAEYKA
DIAKIPLAFEKLEGALKTQSAQGPFFNGTKYSLVDAAYAPFLQRYDFLDRIKPLGTIEKF
PRVKAWAETLLKRPSTHSFPEAEFEGLYRLNVKLRKKYLSQFIADAAVAAE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtatcttctcgtcagcttcaagacttgcccgtgggtgcagcgcgccgccatc
gtgctgcgcgagaagggagtcgacttcgaattccgtcacatcgaccgcgacaaccgcccc
gactggttcctcgccatctcgccgcacaagaaggtgccggtgctgagcgtcgacggcaag
gtgtcgctgttcgagtcgaacgcgatcgccgaatacctggacgagacgatcgcgccgcgg
ctgcatccggaggacccggtgcagcgcgccgtcaaccgtgcctggaccgactttctgccg
accttcgccgacatggtgacggggcaggcctattcggaggacgaggcggagtacaaagcg
gatatcgcgaagattccgttagcgttcgagaagctcgagggcgcgctgaaaacgcaaagc
gcccagggtccgttcttcaacggcacgaaatactcgctggtcgatgcggcctatgcgccg
tttctgcagcgctatgactttctcgatcgcatcaagccgctcggcacgatcgagaagttt
ccgagggtgaaggcgtgggccgagacgctgctgaagcggccgtcgacgcattcattcccg
gaggccgagttcgaggggctgtaccggttgaacgtgaagctgcgaaagaaatatctgtcg
cagttcatcgccgacgccgcggtggcggcagagtag

DBGET integrated database retrieval system