KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_17400Help
Entry
RHPLAN_17400      CDS       T04290                                 

Definition
(GenBank) inositol monophosphatase family protein
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00521  Streptomycin biosynthesis
rhz00562  Inositol phosphate metabolism
rhz01100  Metabolic pathways
rhz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RHPLAN_17400
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHPLAN_17400
Enzymes [BR:rhz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     RHPLAN_17400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AMN40192
UniProt: A0A127EPK4
LinkDB All DBs
Position
complement(1993815..1994597)
Genome map
AA seq 260 aa AA seqDB search
MTAIDFAAFVDRLATVSGDAILPFFRTSLGVENKGGAGGFDPVTAADRAAETAMRTLIRQ
TFPDHGIIGEEFGNERTDAEYVWVLDPIDGTKSFITGMPAWGTLIALTRGGAPVYGMMHQ
PFTRERFTGDGHVARYRGPAGERTLRTRRCAELSEALLMTTSPLLMKEADRASFGKVEHV
ARLSRYGGDCYAYCMLAAGHVDLVIETELKPYDILPLIPIITGGGGIVTAWDGGAPTAGG
RIIAAGDPRVHEAAMKVLRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacagccattgattttgcggccttcgtcgaccggctcgccacggtgtcgggagacgcc
atcctgccgtttttccgcacgtcactgggtgtcgagaacaagggcggtgccggaggcttc
gatccggtgaccgccgccgaccgcgccgccgaaaccgcgatgcggacactcatccgccag
acctttccggaccacggcatcatcggcgaagagttcggcaatgagcgcaccgacgccgaa
tatgtctgggtgctcgatccgatcgacggcaccaagtccttcatcaccggcatgccggcc
tggggcacgctgatcgccctgacgcgcggcggcgcaccggtctacggcatgatgcatcag
ccgttcacccgcgagcgcttcaccggcgacggtcatgtcgcgcgctaccgcggccccgcc
ggcgagcgcacactgcggacgcggcgctgcgcggaactctccgaggcgctcttgatgacg
acgagtccgcttctgatgaaggaggcggaccgcgcaagcttcggcaaggttgagcacgtg
gcgcggctgtcgcgctacggcggcgattgctacgcctactgcatgctcgccgcgggccat
gtcgacctcgtgatcgagaccgagctcaagccctacgacattctgccgctcattccgatc
attaccggcggcggcggcatcgttaccgcctgggacggcggcgcgccaaccgcaggaggc
cgcatcatcgcggccggcgatccgcgcgtgcacgaagccgcgatgaaggtcctgcgcggc
tag

DBGET integrated database retrieval system