KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_34650Help
Entry
RHPLAN_34650      CDS       T04290                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RHPLAN_34650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhz02000]
    RHPLAN_34650
Enzymes [BR:rhz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RHPLAN_34650
Transporters [BR:rhz02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHPLAN_34650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AMN41897
UniProt: A0A127EUH1
LinkDB All DBs
Position
4042208..4042825
Genome map
AA seq 205 aa AA seqDB search
MADITLYHASPSRSSVTLWMLEELGVPYDIKLLKLSEGDQLKPDYLAINPMGKVPAIKHN
DVVITESAAICTYLADAFPEKKLNVPLGDARRGPYLKWLFFGPGCFEPAVIDRAAPRKEE
ARRAMLGYGDFDTVMNVVAKAVEKGPWILGEQFTAADVVIGSNVRWGTIFKLVPERPEFA
AYSARIAARPAAQRAEAKDNELKDK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcacgctgtaccacgcttcaccctcgcgttcgtccgtcacgctttggatg
ctggaagagctcggcgtgccttacgacatcaagctgctcaagctttcggagggcgatcag
ctcaagcccgactatctcgccatcaatccgatgggcaaggtgccggcgatcaagcacaac
gacgtggtgatcaccgagagcgcggcgatctgcacctatctcgccgatgcgtttcccgag
aagaagctcaacgtgccgctcggcgatgcgcgccgcgggccgtatttgaaatggctgttc
ttcgggccgggctgtttcgagcctgcggtgatcgatcgtgccgcgccccgcaaggaagaa
gcgcgccgggcgatgctcggctacggcgatttcgacaccgtcatgaacgtggtggcgaag
gcggtggagaaggggccttggattctgggcgagcagttcaccgcggccgacgtggtgatc
ggctcgaacgtccgctggggcacgatcttcaagctggtgcctgagcggccggagttcgct
gcctattcggcgcgaattgctgcaaggcccgcggcgcagcgcgccgaagccaaggacaac
gagctgaaagacaagtag

DBGET integrated database retrieval system