KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_38700Help
Entry
RHPLAN_38700      CDS       T04290                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00500  Starch and sucrose metabolism
rhz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHPLAN_38700
Enzymes [BR:rhz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RHPLAN_38700
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RHPLAN_38700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AMN42302
UniProt: A0A127EVM2
LinkDB All DBs
Position
4499212..4500876
Genome map
AA seq 554 aa AA seqDB search
MINDLWYKNAVVYCLSVGTYMDANGDGIGDFQGLMRRLDYLHGLGITAIWLMPFQCSPGR
DDGYDISDYYGVNPAYGTLGDFVEFTHAAKQRGIRVLIDLVVNHTSDEHAWFQEARRDPK
SKYRDWYVWSDKKPPNSDKGMVFPGVQKSTWTRDPVAKQWYFHRFYKFQPDLNTSNPAVQ
AEILKIMGFWIQLGVSGFRMDAVPFVISTKGPDVTRPREQYDMLRQFREFLQWRVGDSII
LAEANVLPNTDMQYFGDDGDRMHMMFNFQVNQNLFYALASADTRPLAKAMQRTESRPASG
QWGIFLRNHDELDLGRLTEAQRQQVFDAFGPNKEDQLYDRGIRRRLAPMLGGDRRRIELA
YSLMFTLPGTPVLRYGDELGMGDDLSLRERVCCRTPMQWSTEPHGGFTKSNKPVVPVITD
GPYGFPHVNAAEQRRDSNSMLNWIERIVRMRKEVPEVGWGQFDVLKTGDDAVLGLRYDWK
NNSVLFLHNFAGEPREVAFSTGLKGGLNDNLINLLTADHSRASESGKHSVCLEPYGYRWY
RVGGLDYLLKRSEF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtacaaaaacgccgttgtctattgcctctcggttggcacttac
atggatgccaacggcgacggcatcggcgacttccagggcttgatgcgccgtctcgattat
ctgcacggcctcggcatcaccgcgatctggctgatgccgttccagtgctcgccggggcgt
gacgacggttacgacatctcggactactacggggtcaatcccgcctacggcacgctcggc
gatttcgtcgagttcacacacgccgccaagcagcgcggcattcgtgtgctgatcgacctc
gtggtcaaccacacatctgacgaacacgcttggtttcaagaggcgcggcgcgatccgaaa
tccaaataccgcgactggtacgtctggtcggataagaagccgccgaactccgacaaaggc
atggtgtttcccggcgtgcagaaatcgacctggacgcgcgatcccgtggccaagcagtgg
tacttccaccgcttctacaaattccagcccgatctcaacacgtccaatcccgccgtgcag
gcggagattttgaagatcatgggcttctggattcagctcggcgtatccggcttccggatg
gatgcggtgccgttcgtgatcagcaccaaagggccggatgtcacgcgtccgcgcgagcaa
tacgacatgctgcgccagttccgcgaattcctgcaatggcgcgttggcgactccatcatc
ctcgccgaagccaatgtgctcccgaacaccgacatgcagtatttcggcgatgacggcgac
cgcatgcacatgatgttcaatttccaggtcaaccagaacctgttttacgcgctcgcttcg
gcggatacgcggccactggccaaggccatgcaacgcaccgaaagccgcccggcaagcggg
cagtgggggatattcctgcgcaatcacgacgagctcgatctcggacgactgaccgaagcg
cagcgccaacaggtgttcgacgccttcggaccgaacaaagaggatcagctctacgatcgc
ggcattcgccggcgccttgcgccgatgctcggcggtgaccggcgccgcatcgagctggcg
tacagcctgatgtttacgttgccgggcacgcccgtgctgcgctacggggatgaactcggc
atgggagacgatctttcattgcgcgagcgggtgtgctgccgcacgccgatgcagtggtcg
accgagccccatggcggcttcaccaaaagcaacaaacctgttgtcccggtgatcacggac
gggccttacggcttcccgcacgtcaatgccgccgaacagcgacgcgattccaattccatg
ctgaactggatcgagcgcatcgtccgaatgcgcaaagaagtgccggaggtcggctggggt
caattcgacgttttgaaaaccggtgacgacgccgtgcttggtctgcgctacgattggaag
aacaattcggtgttgttcctgcataattttgccggcgaaccgcgcgaggtcgcgttttcg
acaggcctgaaaggcggcttgaacgacaatctgatcaatctgctcaccgccgatcacagc
cgggcatcggagagcggcaagcacagcgtttgcctggagccttacggctatcgttggtat
cgggtgggcggtctcgactacttgctgaagcgaagcgagttttaa

DBGET integrated database retrieval system