KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_39300Help
Entry
RHPLAN_39300      CDS       T04290                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rhz00405  Phenazine biosynthesis
rhz01100  Metabolic pathways
rhz01110  Biosynthesis of secondary metabolites
rhz01130  Biosynthesis of antibiotics
rhz01230  Biosynthesis of amino acids
rhz02024  Quorum sensing
Module
rhz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHPLAN_39300
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    RHPLAN_39300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHPLAN_39300
Enzymes [BR:rhz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     RHPLAN_39300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AMN42362
UniProt: A0A127EVT2
LinkDB All DBs
Position
complement(4566484..4568001)
Genome map
AA seq 505 aa AA seqDB search
MQIEPRADAFSTRYGRGEAQVVWTTLVADLQTPVSAFLKIAGGRPMSFLLESVEGGAVRG
RYSVIGLDPDVVWRSASGRAEINRTARTDADHFIACDAPPLEALRALIAESRIALPDGLP
PMAAGVFGYLGYDMVRLMEDLPASHPDPIDIPDAVLIRPTLIVVFDAVKDSITVVTPVRP
EPGVIAKVALARAEERLSAVVDALDRPLDKTAVGSEAGPLDVPAKSNTTPAEYQAMVQKA
KEYILAGDIFQVVLSQRFQAPFTLPPFALYRALRRVNPAPFLYFLDFGGYAVAGSSPEIL
VRVRSDVVTIRPIAGTRPRGETPHDDKALEEELLADPKERAEHLMLLDLGRNDVGRVARI
GSVKVTDRFFIERYSHVMHIVSNVEGVLSDRCDSLDALAAGFPAGTVSGAPKVRAMQIID
ELEKEKRGLYAGCVGYFSAAGEMDSCIVLRTALIKDGTMYVQAGAGIVADSNPASEQAEC
VNKAKALFRAAEEARRFASAASRGQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgagccgcgggctgacgccttttccacgcgttacggccgcggcgaggcgcaa
gtggtctggaccacactggtcgccgacctgcaaacgccagtgtcggcgttcctcaagatc
gccggcgggcgcccgatgagcttcctgctggagtcggttgaaggcggtgcggtgcgcggc
cgctactcggtgatcgggctcgaccccgacgtggtgtggcgctccgcctccgggcgtgcc
gagatcaaccgcacggcgcggaccgatgccgaccatttcatcgcctgcgacgccccgccg
cttgaagcgcttcgcgcgctgatcgccgaaagccgcatcgcgttgccggatggcctgccg
ccgatggcggcgggcgtgttcggctatctcggttacgacatggttcggctgatggaggat
ctgccggcctcccatcccgatccgatcgacattccggacgccgtcctgatccgcccgacg
ctcatcgtggtattcgatgccgtcaaagacagcatcacggtggtgacgccggtgcgaccg
gaaccgggcgtcatcgcaaaggtcgcgctggcgcgcgccgaagagcggctgtccgcggtg
gtcgatgcgctcgaccggccgctcgacaagaccgccgtgggctcggaggccggtccactc
gacgttccggcgaaatccaacaccacgcccgccgaataccaggcgatggtccagaaggcc
aaggagtacatcctcgccggcgacatcttccaggtggtgctgtcgcagcgcttccaggcg
ccctttacgctgccgccctttgcgctctatcgcgcgctgcggcgagtcaatccggcgccg
tttctctactttctcgacttcggcggctatgcggtcgcgggctcgagccccgagatcctg
gtgcgggtgcgctcggatgtcgtgacgatccgcccgatcgcgggcacgcggccgcgcggc
gagacgcctcatgacgacaaggcgctggaagaagaactcctcgccgacccgaaggagcgc
gccgagcacctgatgctgctcgatctcggtcgcaacgacgtcggccgcgttgccaggatc
ggcagcgtcaaggtcaccgaccggttcttcatcgagcgctacagccacgtcatgcacatc
gtttccaacgtcgagggcgtgttgtccgaccggtgcgactcgctcgatgcgctggccgcg
ggcttccctgccggcacggtgtctggcgcgcccaaggtgcgcgccatgcagatcatcgac
gaactggagaaggaaaagcgtgggctctacgccggctgtgtcggctacttttcagcagcc
ggcgaaatggactcctgcatcgtgctgcgcaccgcgctgatcaaggacggcaccatgtac
gtgcaggcgggcgccggcatcgtggccgacagcaatcctgcgagcgaacaggccgaatgc
gtcaacaaggccaaggccctgttccgcgccgccgaagaggcgcggcgttttgccagcgcg
gccagccgcggacagtag

DBGET integrated database retrieval system