KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_58360Help
Entry
RHPLAN_58360      CDS       T04290                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz00473  D-Alanine metabolism
rhz00550  Peptidoglycan biosynthesis
rhz01100  Metabolic pathways
rhz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RHPLAN_58360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RHPLAN_58360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RHPLAN_58360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhz01011]
    RHPLAN_58360
Enzymes [BR:rhz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RHPLAN_58360
Peptidoglycan biosynthesis and degradation proteins [BR:rhz01011]
 Precursor biosynthesis
  Amino acid ligase
   RHPLAN_58360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AMN44249
UniProt: A0A127F415
LinkDB All DBs
Position
complement(6731309..6732229)
Genome map
AA seq 306 aa AA seqDB search
MSKHVAVLMGGWSAEREISLRSGRACADAAERAGFRVTRVDVGRDIANVLTTLKPDAALN
VLHGRPGEDGTLQGILEILGIPYSHSGVMASAVAMQKDVAKVVMKAGGVPVPDGRVVSRH
EAAKSHPLPRPYVLKPIAEGSSVGVFIVTEQHEHPPQELTREDWAFGEQVLCERYIPGKE
LTCAVMGDKALDVIEIVAATQFYDFEAKYAPGGSKHVLPAKISPFVYQEVRRLALKAHYA
LGCRGVTRADFRYDDQAAGTEGLVCLEVNTQPGMTETSLVPELAAYAGVNFEELVRWMVE
DASLNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacacgtcgccgttctcatgggcggctggtcggcggagcgcgaaataagcttg
cgctcgggccgcgcctgcgccgacgcggcggagcgtgcaggcttccgcgtcacgcgcgtc
gatgtcggccgcgacatcgcaaacgtgctgacaacgctgaagcccgacgcggcgctcaat
gtgctgcacggccggcccggcgaggacggcacgctgcagggcatcctggagatcctcggc
attccctacagccattccggtgtgatggcctccgccgtggccatgcagaaggacgtcgcc
aaggtggtgatgaaggccggcggcgttccggtgccggacggcagggtcgtgtcgcgccac
gaggccgccaaatcccacccgctgccgcgcccctacgtgctcaagccgatcgcagaaggc
tccagcgtcggtgtgttcatcgtcaccgagcagcatgagcacccgccccaggaactgacc
cgggaggattgggccttcggcgagcaggtgctgtgcgaacgctacatccccggcaaggaa
ctgacctgcgcggtcatgggcgataaggccttggacgtcatcgagattgtggctgcgacc
cagttctacgatttcgaggcgaaatacgctccgggcggatcaaagcacgttttgccggca
aaaatttcaccttttgtttaccaagaggtccgaagactagcgctcaaggcgcattacgcc
ctcggttgccgaggcgtgacccgcgctgacttccgctacgacgatcaggccgcggggacg
gagggcttggtctgtcttgaggtcaacactcagcccggcatgaccgaaacttcgctcgtg
cctgagcttgcggcttacgcgggcgtgaatttcgaagagctggtgcgatggatggtcgaa
gacgcatcgctgaatcggtaa

DBGET integrated database retrieval system