KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_64340Help
Entry
RHPLAN_64340      CDS       T04290                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Pathway
rhz03030  DNA replication
rhz03410  Base excision repair
rhz03420  Nucleotide excision repair
rhz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rhz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RHPLAN_64340
   03410 Base excision repair
    RHPLAN_64340
   03420 Nucleotide excision repair
    RHPLAN_64340
   03430 Mismatch repair
    RHPLAN_64340
Enzymes [BR:rhz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RHPLAN_64340
    6.5.1.6  DNA ligase (ATP or NAD+)
     RHPLAN_64340
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RHPLAN_64340
DNA replication proteins [BR:rhz03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RHPLAN_64340
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RHPLAN_64340
DNA repair and recombination proteins [BR:rhz03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RHPLAN_64340
   NER (nucleotide excision repair)
    Other NER factors
     RHPLAN_64340
   MMR (mismatch exicision repair)
    Other MMR factors
     RHPLAN_64340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AMN44840
UniProt: A0A127F5L8
LinkDB All DBs
Position
7432737..7434404
Genome map
AA seq 555 aa AA seqDB search
MNRFAELLDRLAYEPSRNNKLRLIADYLRSTPDPERGFALAGLTGALSFQHAKAGMIRAL
IAERTDPVLFEISYDYVGDLSETVALMWPADPSQKPNSTPSLSEVIETLATLGKTQLPKQ
LARWLDGLDETGRWALLKLVTGALRIGVSARLAKTAAASLGDKEPNEVEILWPGLSPPYT
ALFAWLEGRADKPQTRDLAPFRPAMLAHAIEETDFAALNPTDFTAEWKWDGIRVQAAAAG
SGEGHIARLYSRTGEDISKSFPDLAEALRLPGSIDGELLILRDGRVQSFNVLQQRLNRKA
VTPKLLQEFPAHLRAYDLLVDGDEDLRDKPFAERRMRLETFVTRLNDPRIDLSPMVPFNT
WDELTAARADPAKSGAGQDAGAVEGVMLKRRDSIYVPGRPKGPWWKWKRDPFTVDAVLMY
AQRGHGKRSSYYSDYTFGVWKAGEGGDELVPVGKAYFGFTDEELQKIDRFVRNNTVERFG
PVREIAHEPDKGLVFEVAFEGLQRSTRHKSGLAMRFPRISRLRWDKPPREADRIDVLESI
LSKIESGRGPARAAS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcttcgccgagcttctcgaccgcctggcctacgagccgtctcgcaacaacaag
ctgcggctgatcgcggactatctgcgctcgacgcccgatcccgagcgtggctttgcgctc
gcggggctgaccggtgcattgtcgttccagcacgccaaggcgggcatgatccgcgcgctg
atcgccgagcgcaccgatccggtgctgttcgaaatttcttacgactatgtcggcgatctt
tccgaaacggtggcgctgatgtggcctgccgacccgtcgcagaaacccaactccacgccg
tcgctatcagaggtgatcgaaacactcgccacgctcggcaagacccaattgccgaagcag
ctcgcgcgctggctcgacggtctcgacgagaccggccgctgggcgctgctcaagctggtg
accggagcattgcgcatcggcgtctccgccaggcttgcgaaaactgccgcagcctcgctc
ggcgacaaggagccgaacgaagtcgaaatcctgtggcccggcttgtcgccaccctacacc
gcgttattcgcctggctcgagggccgcgccgacaagccccagacccgcgaccttgcgccg
ttccgcccagcaatgctggctcatgccatcgaggaaaccgatttcgccgccctgaacccg
acggacttcaccgccgaatggaaatgggacggcatccgcgtgcaggcagccgcggccggc
tccggcgaaggccatatcgcgcggctttattcgcgcaccggcgaggacatctcgaaaagc
tttcccgatctcgccgaggcgctgcggctgcccggctcgatcgacggcgagctgctgatc
ttgcgcgacggccgcgtgcagtcgttcaacgtgttgcagcagcggctcaaccgcaaggcc
gtgacgccgaagctgctgcaggaatttccggcgcatctgcgcgcctatgatctgctcgtc
gacggcgacgaggacctgcgcgacaagccctttgccgaacggcggatgcgtctggaaaca
ttcgtcacaaggctcaacgacccgcgcatcgatctgtcgccgatggtgccgttcaatacc
tgggacgaactgaccgccgcacgcgccgacccggcgaaatccggcgccggccaggacgcc
ggggccgtcgaaggcgtcatgctcaaacgccgcgactcgatctacgtgcccggccggccg
aaaggcccgtggtggaaatggaagcgcgatccgttcacggtcgacgccgtgctgatgtat
gcccagcgcgggcacggcaagcgctcgtcctactactccgattataccttcggggtctgg
aaggccggcgaaggcggcgacgaactggtccccgtcggcaaggcctatttcggcttcacc
gacgaggagttgcagaagatcgaccgcttcgtgcgcaacaacaccgtcgagcgcttcggc
ccggtgcgtgagatcgcgcatgaacccgataagggcctggtgttcgaggtcgccttcgag
ggcctgcagcgctcgacccggcacaaatccggccttgccatgcggtttccccgtatcagc
cggctgcgctgggacaagccgccgcgcgaagctgaccggatcgacgtgctggagtcgatt
ctcagcaaaatagaaagcgggcgtggccccgcccgcgcggcgtcatga

DBGET integrated database retrieval system