KEGG   Rathayibacter iranicus: C7V51_02200Help
Entry
C7V51_02200       CDS       T05878                                 

Definition
(GenBank) mismatch-specific DNA-glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
ria  Rathayibacter iranicus
Pathway
ria03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ria00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    C7V51_02200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ria03400]
    C7V51_02200
Enzymes [BR:ria01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     C7V51_02200
DNA repair and recombination proteins [BR:ria03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     C7V51_02200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AZZ54826
LinkDB All DBs
Position
467406..467987
Genome map
AA seq 193 aa AA seqDB search
MPFSRAELASFQGRTVEDLLGDDVRLLFVGINPGLWTAATGAHFAHPGNRFYPALVAAGI
LDRPLRVSEGMGDADREALLSRGIGITNLVARATARADELTREELRAGAERLVATVQRAR
PAAVALVGITAYRAAFGRRTAKQGRQVEDLAGVPLWVLPNPSGLNAHDTVASLGRAYREP
ARAAGVVPPDPEE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctcccgcgctgagctcgcctcgttccagggccgcacggtcgaggacctgctc
ggggacgatgtccgcctcctcttcgtcggaatcaaccccggcctgtggactgccgcaacc
ggtgcgcacttcgcgcatcccggcaatcgcttttacccggcgctcgtcgccgcaggcatc
ctcgaccgacccctgcgcgtttcggagggaatgggggatgccgaccgggaggctctgctc
tcgagagggatcggcatcacgaacctcgtcgccagggcgaccgcgcgcgccgacgagctg
actcgcgaggagttgcgcgcgggggccgagcgcctcgttgccacagtgcagcgcgcgcga
ccggccgccgtcgctctcgtcgggatcaccgcctaccgcgctgcgttcggccgccgcaca
gcgaagcagggtcgccaagtggaggatctcgcgggagtgccgctctgggtgctgccgaac
ccgagcgggctgaacgcgcacgacacggtcgcctcgcttggacgcgcctaccgcgagccc
gcaagggccgcaggagttgtccctcccgaccccgaggaatag

DBGET integrated database retrieval system