KEGG   Rathayibacter iranicus: C7V51_15295Help
Entry
C7V51_15295       CDS       T05878                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ria  Rathayibacter iranicus
Pathway
ria00521  Streptomycin biosynthesis
ria00562  Inositol phosphate metabolism
ria01100  Metabolic pathways
ria01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ria00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    C7V51_15295
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C7V51_15295
Enzymes [BR:ria01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     C7V51_15295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AZZ57084
LinkDB All DBs
Position
3243286..3244098
Genome map
AA seq 270 aa AA seqDB search
MSDHASLLAIARSVAVEAAHLARQRRQDGVEIAASKSSPEDVVTAADREVEQLIRRRIDE
ARPDDGFLGEESGAGGGTSGLTWVVDPIDGTVNYLYGIPSYAVSIAVVEGEPDPVTWTAL
AGAVVNGATGEVTTASRGQGAERNGVELRVAVPPSLSLALVGTGFGYDAGRRMRQGAVVQ
ELLGSVRDIRRIGSAALDLCSVATGQLNAYYERGLNPWDLAAGALIAQEAGARVAGLDGA
PFGSGMLIAAPDPLFVELEELLRRLRADEV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccacgcctccctccttgccatcgcccgctcggttgccgtcgaggcggcgcac
ctcgcccgtcagcggcggcaggacggagtcgagatcgccgcatcgaagtcctcgccggag
gacgtggtgacggcggccgatcgcgaggtcgagcagttgattcgccgccgtatcgacgag
gcacggccggatgacggattcctcggggaggagtcgggtgcgggcggtgggaccagcggg
ctgacctgggtcgtcgatccgatcgacggcaccgtcaactacctctacggcatcccctcg
tacgcggtgagtatcgcggttgtcgagggtgaaccggacccggtgacctggacggcgctc
gccggcgcggtcgtgaacggcgcgacgggcgaggtcaccaccgcgagccgcggtcaggga
gcggaacgcaacggcgtcgagctgcgtgtcgcggttccgccgtcactctctctcgctctc
gtcggcacagggttcggctacgacgccggccgccggatgcggcagggtgcggtggtgcag
gagctgctcggctcggtccgtgacatccgacgcatcgggtcggctgcgctggacctgtgc
tcggtggcgacagggcagctgaacgcctattacgagcgggggctcaacccgtgggacctg
gccgcgggcgcgctcatcgcgcaggaggcgggcgcgcgggtagcgggcctggacggcgct
cccttcggctccggcatgctcatcgcggcgccggacccgctcttcgtcgagctggaggag
ctgctgcgccgcctgcgcgcggacgaggtctag

DBGET integrated database retrieval system