KEGG   Candidatus Riesia sp. GBBU: AOQ88_01810Help
Entry
AOQ88_01810       CDS       T04782                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rig  Candidatus Riesia sp. GBBU
Pathway
rig00473  D-Alanine metabolism
rig00550  Peptidoglycan biosynthesis
rig01100  Metabolic pathways
rig01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rig00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOQ88_01810
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOQ88_01810
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AOQ88_01810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rig01011]
    AOQ88_01810
Enzymes [BR:rig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOQ88_01810
Peptidoglycan biosynthesis and degradation proteins [BR:rig01011]
 Precursor biosynthesis
  Amino acid ligase
   AOQ88_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ARC54969
UniProt: A0A1V0HQ65
LinkDB All DBs
Position
complement(371238..372155)
Genome map
AA seq 305 aa AA seqDB search
MKEKVAVLFGGNSFEREISIKSGKEVEKVLKKYGIETYLVDTKYSPVRKLRNMNFSKAFI
MLHGKNGEDGIVQRALETLNIPYTGSGVFTSFISFNKINTKKFLKSIGLPVIPYLIFQKS
KIKSLKYKLLSYIIRDFKFPVVVKPNCCGSSLGISVVNSLGSLKKAIKKAFLYDDNILLE
KYLFGLEYSVSILDGEKLPSIRIETDQKFYNFHAKYFSNKTRYICPGGMNLNEENELRKL
SMFVYKSAKCSNFARIDLIKDINDVFYILEINTIPGMTRKSLFPMSAKRVGIGFSKLVLK
ILKNC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagtagcagttctttttggaggaaactcttttgagagagaaatatcaatt
aagtcaggaaaagaagtagaaaaagttttaaaaaaatatggaattgaaacatatcttgta
gacacgaaatattcaccagtaagaaagttgagaaatatgaacttctcaaaggcatttata
atgcttcatggtaaaaatggagaagatggaatagtacaaagagcgttagaaacattaaat
attccatatactggaagtggagtatttacttcttttatatctttcaataaaataaataca
aaaaaatttttaaaatcgattggacttcctgttattccatatttaatttttcaaaaatca
aagattaaaagtttaaaatataagttgctttcttatattataagagattttaaattcccg
gttgttgttaagcctaattgttgtggatctagcttaggaataagtgtagtaaattctttg
ggatcgttaaaaaaagctataaaaaaagcctttttgtatgatgataatattttacttgaa
aagtatttatttggtttagaatatagcgtttcaatcttagatggagaaaagttaccatct
attagaatagaaacagatcagaaattctataattttcatgcaaaatatttttcaaataaa
acaagatatatctgtcctggaggaatgaatcttaacgaagaaaatgagttaagaaaatta
tcaatgtttgtttataagtctgctaaatgctctaattttgcaagaatagatttaataaaa
gatataaatgacgttttttatattttggaaattaatactatacctggaatgactaggaaa
agtttatttccaatgtcggcaaagagagttggaataggattctcaaagttagttttaaag
attttaaaaaactgttaa

DBGET integrated database retrieval system