KEGG   Roseburia intestinalis M50/1: ROI_01220Help
Entry
ROI_01220         CDS       T02598                                 

Definition
(GenBank) ABC-type amino acid transport/signal transduction systems, periplasmic component/domain
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
rim  Roseburia intestinalis M50/1
Pathway
rim02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rim00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ROI_01220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rim02000]
    ROI_01220
   02035 Bacterial motility proteins [BR:rim02035]
    ROI_01220
Transporters [BR:rim02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    ROI_01220
Bacterial motility proteins [BR:rim02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    ROI_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd DUF1902 DUF4995
Motif
Other DBs
NCBI-ProteinID: CBL07471
UniProt: D4KKR9
LinkDB All DBs
Position
complement(117756..118610)
Genome map
AA seq 284 aa AA seqDB search
MKKKVISILLTAVLATGMAACGSNSNTAGNSANNTADNAQNTAETSTESTGSADSAEKPV
LTVGMEGTYAPYTYHDENGTLTGFEVDMANAIGEKMGYDVQFVETEWDSITAALDAGNFD
VVMNQVTITDERKERFDFSTPYIYSKPVLIVAADNTDINSFEDINGKKAAEGLTSNFSDI
ARSYGAEIVGQDKFALAMECVLSGEADCAINDELTYAYWKQQKGGEDSTKIVAESDNVNS
SAIMVKKGNDELIEKLNSAIDELLADGTVKEISEKYFGMDVSQP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagtgatttcaattttactgacagccgttttagcaacaggaatggcagca
tgcggttctaacagcaatacagcaggtaattctgcaaataatacagctgacaatgcacag
aacacagctgaaacttcaacagaatccacaggttctgctgattctgctgaaaaacctgta
ttaactgtcggcatggagggaacttatgctccatacacctaccacgatgaaaatggtact
ttaaccggttttgaggttgatatggcaaatgcaatcggtgaaaagatgggctatgatgtc
cagtttgttgagacagagtgggattccatcactgctgcacttgatgccggcaactttgac
gttgtcatgaaccaggttacgatcacagatgagagaaaagaaagattcgatttttccacc
ccttacatttattccaaaccagtgctgatcgtagctgctgacaatactgatatcaattcc
ttcgaagacatcaatggtaaaaaagctgcagaaggtcttacctcaaacttcagcgatatt
gcaagaagctacggcgcagagatcgtcggacaggataaatttgcacttgccatggaatgt
gtattaagtggggaagccgattgtgcgatcaacgacgaattaacttacgcatactggaaa
cagcagaaaggcggcgaggactccaccaagatcgttgctgaatctgataatgtcaattcc
agtgccattatggtgaaaaaaggcaatgacgagctgattgaaaaactcaattctgccatt
gatgaattattagcggacggaaccgtcaaagaaatttccgaaaaatattttggcatggac
gtatcacagccataa

DBGET integrated database retrieval system