KEGG   Roseburia intestinalis M50/1: ROI_22520Help
Entry
ROI_22520         CDS       T02598                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rim  Roseburia intestinalis M50/1
Pathway
rim01100  Metabolic pathways
rim01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rim00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ROI_22520
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ROI_22520
Enzymes [BR:rim01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ROI_22520
Peptidoglycan biosynthesis and degradation proteins [BR:rim01011]
 Precursor biosynthesis
  Racemase
   ROI_22520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBL09253
UniProt: D4KQV1
LinkDB All DBs
Position
2270630..2271799
Genome map
AA seq 389 aa AA seqDB search
MNRYSRVHAEIDLDAILHNMDAMRGNIAKDTKIMAVIKADGYGHGAVEIAETIEKLDYLY
GYAVATVEEGLILRNHGIQKPILILGYVFPDQYVDMIKAGIRPTVFTREMAEKLSVAAAS
IGRDCKIHFAIDTGMSRIGYQVTEEAADEMAQLSKLPHIIVEGIFTHFAKADEKDKEPTY
QQIKLFRKMIDMLEERGVSILIHHCSNSAGIVDIPEANMDMVRAGITLYGMWPSEDVDKT
AISLKPALSLVTHVAYVKELPAGRAISYGGTYVTKEPRMIATIPVGYADGYARGLSNKGA
VLIHGRRAPILGRVCMDQFMVDVTDIPDVKNEDEVILIGRDGDECITMEEVGGLSGRFNY
EFACDLGKRIPRVYIHGGRIIGTRDHFSE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacagatacagcagagtgcatgcggagatcgatctggatgcaattcttcacaacatg
gatgcaatgcgtgggaacattgcaaaagatacaaaaattatggcggtcatcaaggctgac
ggctatggacatggtgccgtagagattgcagagacgattgaaaaacttgattatctatac
ggttatgcggttgccacggtggaagagggactgatccttcgaaatcacgggatccagaaa
ccaatcctgatcttaggatatgtgttcccggatcagtatgtggatatgatcaaagcgggc
atccgtccgaccgtatttaccagagagatggcagaaaagctttccgttgcggctgcaagt
atcggcagggactgcaagattcattttgcaattgataccggaatgagccggatcggttat
caggttacggaagaagctgcggatgagatggcacagctttcaaaactaccgcatattata
gtggagggtatttttacccattttgcaaaagcagatgaaaaagataaggagccgacatac
cagcagataaaacttttccgtaaaatgatcgacatgttagaagaacgcggggtaagtatc
ctgattcaccactgctcaaacagtgcaggaattgtcgatatcccggaggcaaacatggat
atggtgcgtgcagggattacgctttatggaatgtggccgtctgaggacgtggataagacg
gcaatcagcttaaaacctgcattatcgcttgtgacacatgttgcatatgtaaaagagctt
ccggctggcagggcaatcagttatggcggaacttatgtcacaaaagaaccgcgtatgatt
gcaacgatcccggtcggttatgcagacggctacgcgagaggactttcaaacaaaggagct
gttctgatccacggaaggcgtgcaccgattcttggccgtgtctgtatggatcagtttatg
gtagatgtcacagatattccggatgttaaaaatgaggatgaagtgatactgatcggcagg
gatggtgatgagtgcattaccatggaagaggtcggcgggttatccggacgttttaattat
gaattcgcctgtgatcttggaaaacgtataccacgtgtttatatccatggtggacggatc
atcggtacgagagatcatttttcggaataa

DBGET integrated database retrieval system