KEGG   Roseburia intestinalis M50/1: ROI_28070Help
Entry
ROI_28070         CDS       T02598                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rim  Roseburia intestinalis M50/1
Brite
KEGG Orthology (KO) [BR:rim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rim01001]
    ROI_28070
Enzymes [BR:rim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ROI_28070
Protein kinases [BR:rim01001]
 Serine/threonine kinases: Other
  Bacterial family
   ROI_28070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo ATG19_autophagy RIO1 Haspin_kinase EphA2_TM Pkinase_fungal OAD_gamma ODV-E18
Motif
Other DBs
NCBI-ProteinID: CBL09724
UniProt: D4KS72
LinkDB All DBs
Position
complement(2812261..2814372)
Genome map
AA seq 703 aa AA seqDB search
MLTEGMYIADRYEILGKVGAGGMSDVYKAKDLTLGRFVAIKVLKAEFSEDINFVTKFRSE
AQAAAGLEHPNIVNIYDVGSENGLHYIVMEYVEGITLKTYIEKKGQLSFKEAVSIAIQVG
RGIEAAHNKNIVHRDIKPQNIMISTEGKVKVTDFGIARAATSNTISSDVMGSVHYSSPEQ
ARNGFVDGKSDIYSLGIVMYEMVTGRVPFDGDTTVAVAIQHLQEEIVPPSVYAPNLPISM
EKIILKCTQKNPDRRYASMTALLADLRKALISPNEDFVVMVPLANQDKTRVIGADDLNQI
KKQTANVYIDPASIKIQEPVIDDDDEDDDDDIDDEDGDINPKMEKAITIMGIAAGVVIII
IIIYLCITLAGGMKSNKNNSSNTETTKTETQTGDSQSTQIKDGVVVPSLTGKTMDQAKQE
LNGTGLGIRQAGTASSDTVEKGQIISQDPADGKTVEKNTTIEVIISSGSAAGTSENTVEI
PNVVGQSETDASAALTAKGFQVTKTTSYSSSVAEGYVISQTPNGDTKGKEGDTITLEISL
GSEKITVPDVSTSYKSEEQAKELLSQFNVSTVTKYSDTDAGIVIGQSLAVGTQADPGASI
TITVSLGPEPAQQITTKTYKLNVSLQLPSDTSNISGADIVLYDDQGNVLQTWYGKTIADF
GTGGLILTKTGILSDSGKIVVTWLDLNGNDLKDQTIDVQFQEE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgttgacagaaggtatgtacatagcagaccgctatgaaattttaggtaaagttggcgct
ggcggaatgtcagatgtatataaagcaaaagatcttacactgggaagatttgtagcaatc
aaggtattaaaggcagaattttccgaggatattaatttcgtaacgaaattccgttccgag
gcacaggcagctgcagggttagagcacccgaatattgtaaatatttatgatgtcggcagt
gagaatggcctgcattatatcgtgatggaatatgtggaaggaatcacattaaagacctac
attgagaaaaaaggacagctttcttttaaggaggcagtcagcatcgcaattcaggtgggc
agaggtattgaagccgcccataataaaaatatcgtgcatcgtgatatcaaaccgcagaat
atcatgatctccacagagggaaaagtaaaagtaacagattttggtattgcgcgggcagca
acatcaaatacgatcagttcggatgtgatgggatccgtacattattcttctccggaacag
gcgagaaatggatttgtggatggcaagagtgatatctattcactgggtatcgtgatgtat
gagatggtaacaggccgtgttccgtttgacggggatacgacggtcgcagttgcaatccag
catctgcaggaagagatagtaccgccaagtgtttatgcaccaaatcttccaatcagtatg
gaaaagatcatcttaaaatgtacacagaaaaaccctgacagaagatatgcttccatgaca
gcgcttctggccgatcttagaaaagcactgatcagcccgaacgaggattttgttgtgatg
gtacctcttgcaaatcaggataagacgagggtgatcggagcagatgatttaaatcagatc
aagaaacagactgcaaacgtctatatagatccggcgtcgatcaaaatacaggagccggtg
atcgatgatgatgacgaggacgacgatgatgatattgatgacgaggatggtgatatcaat
ccgaagatggaaaaggcaatcacgatcatgggaatcgcagcaggtgtagtgatcattatc
atcattatttacctgtgcatcacgttagccgggggtatgaagtctaacaagaacaattct
tcgaatacagaaacaacaaaaacggaaacacagacgggagacagtcagagtacccagatc
aaggacggtgtagtagtaccttccctgacaggaaaaaccatggatcaggcaaaacaggag
ttaaacggaaccggactcggcatcagacaggctggaaccgcatcctctgataccgtagaa
aagggacagatcataagccaggatccggcagatggtaagactgttgaaaagaatacaacg
atcgaagttatcatcagcagcggatctgccgccggaaccagtgagaatacggtcgaaata
ccaaacgttgtgggacagagtgagacagatgccagcgcggcattgacggcaaagggattt
caggtcacaaagacaacttcctacagttcctccgttgcggaaggatatgtaatttcccag
acaccaaatggggataccaagggaaaagagggcgatacgatcacacttgagatcagcctt
ggctcagagaagattacagtacctgatgtatcgacaagctataagtcagaggaacaggcg
aaagaacttttatcacagtttaatgtttcaacggtcacaaaatacagtgatacggatgcc
ggaatcgtaatcggacagtcacttgcggtgggaacacaggcagatccgggagcatccatc
acgatcacagtcagtcttggaccggaaccggcacagcagatcaccacaaagacttataag
ctgaatgtcagcctgcagcttccatcagatacatcgaatatctccggtgcagacattgtt
ttatatgatgatcagggcaatgttttacagacctggtacggcaaaacgattgcagatttt
ggtactggcggactgattctgacaaagaccggtattctttcggacagtggtaaaatcgta
gttacctggctggacttaaatggaaatgatttaaaagaccagacgattgatgtacagttc
caggaagaataa

DBGET integrated database retrieval system