KEGG   Ralstonia insidiosa: ACS15_0651Help
Entry
ACS15_0651        CDS       T04471                                 

Definition
(GenBank) glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rin  Ralstonia insidiosa
Pathway
rin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACS15_0651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rin02000]
    ACS15_0651
Enzymes [BR:rin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACS15_0651
Transporters [BR:rin02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACS15_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANH71830
LinkDB All DBs
Position
1:complement(659983..660651)
Genome map
AA seq 222 aa AA seqDB search
MSQDRHLILYHSPRSRSRGVRMLLEELGADYELRPFDLTTGQHHTPEFLAINPLGKVPTL
RHGDVVVTEQAAVYMYAAELYPEAGLSPAVGDPLRGAYLRWMVFYGACFEPAVVDRSMNR
PSANYSMSPYGDFDTVISTINAQLAKGPYLLGERFTAADVLWGAALDWITKFKLMPETPV
VRAYIDRVMARPAIQRAQAADLALAEQQDAAKAAASAAAPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagaccgccacctgatcctctaccactccccgcgcagccgctcgcgaggcgtg
cgcatgctgctcgaggaactgggcgccgactatgaactgcgcccgttcgacctgaccacg
ggccagcatcacacccccgagtttcttgccatcaacccgctgggcaaagtgccgacgctg
cgtcacggtgatgtggtggtgaccgagcaagccgccgtctacatgtatgcggcagagctg
tatccggaagccggtctgtcaccggcagtgggcgatccgctgcgcggcgcatacctgcgt
tggatggtgttctatggcgcgtgctttgagccggccgtggtggaccgctcgatgaaccgt
ccgtcggccaactactccatgtcaccgtatggcgactttgacaccgtgatcagcacgatc
aacgcgcagctcgcaaagggtccttacctgctgggggaacgcttcacggcggcagacgtg
ctgtggggtgccgcgttggattggatcacgaagttcaagctgatgccggaaacacccgtg
gtacgcgcctacattgaccgcgtcatggcacgcccggccatacaacgtgcgcaagcggcc
gatctggcgctggcggaacaacaggacgcagccaaggcggccgccagcgcagccgccccg
ggagcctga

DBGET integrated database retrieval system