KEGG   Ralstonia insidiosa: ACS15_1782Help
Entry
ACS15_1782        CDS       T04471                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
rin  Ralstonia insidiosa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ANH74780
LinkDB All DBs
Position
1:complement(1782567..1784003)
Genome map
AA seq 478 aa AA seqDB search
MQQRDKLFINGKWVAPQGKGVIEVIHSATEAVMGTIPEGSAADAEAAVAAARAAFDGWAA
TPVAKRAEYIQKIADGLKARGEELAQLIAGEVGMPIKLARAIQVGGPVFNWGNFAKLTAK
FEFEEQVANSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEEAGLPPGVFNLVTGYGPVVGEVLASHPDVDMVSFTGSTRAGKRVAELAAQTVK
RVALELGGKSASVILDDADLSAAVKGTLSACFLNSGQTCSAHTRMLVPRAKYEEVKALAA
QFAAAYVPGDPAQETTRLGPLISAVQRDRVLGYIRRGLEEGAELITGGADAPEGLSTGFF
VKPTVLGNVKTTDTVAREEIFGPVLTVICYDNEDEAIRIANDSIYGLGGGVWSGDEARAI
RVARRIRTGQVDINGGPFNMQAPFGGYKQSGNGRENGKYGLEEFLEYKALQLKPAQTA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacgcgacaagcttttcatcaatggcaagtgggtggcgccgcagggcaagggc
gtcattgaagtgattcattcggccaccgaagcggtgatggggacgatccctgaaggcagc
gctgccgatgccgaagccgccgtagccgccgcccgcgcagcgtttgatggctgggccgct
acgcccgtggccaaacgcgccgagtacatccagaagatcgccgacggcctcaaggcccga
ggtgaagaactggcgcaactgattgccggtgaagtcggcatgccgatcaagctggcgcgc
gccatccaggtgggtggcccggtgttcaactggggcaattttgccaagctaacggccaaa
ttcgagtttgaagagcaggtcgccaactcgctggtggtgcgcgagccggtaggtgtggtg
ggcgccatcacgccgtggaattacccgctcaaccagatcacgctgaaggttgcgcccgca
ctggctgccggctgtacggtggtgctcaagccgtcggaagtggcgccgctcaacgcgttt
gtgctggctgaagtcattgaagaggccggcctgccaccgggcgtgttcaacctcgtcacc
ggctatggcccggtggtgggtgaggtgctggcgagccatccggatgtcgacatggtgtcg
ttcacgggttcgacgcgcgcgggcaagcgtgtggccgagctggcagcacaaacggtcaag
cgcgtggcgctggagctgggcggcaagtccgcctcggtgatcctggatgacgcagacctg
tcggcggcggtcaagggcacgttgtcggcgtgtttcctgaactcgggacagacctgctcg
gcgcacacacgcatgctggtgccgcgtgccaagtacgaggaagtgaaggcgttggccgcg
caattcgcggcggcctacgtgccgggcgatccggcgcaggaaaccacgcgcctgggcccg
ctgatctccgccgtacagcgcgaccgcgtgctcggctatatccgccgcggcctggaagag
ggcgctgaactcatcaccggtggcgctgatgcgccggagggcttgtccaccggcttcttt
gtcaagccgaccgtgctgggcaacgtcaagaccaccgacaccgtggcgcgcgaagagatc
ttcggcccggtgctcaccgtgatctgctacgacaacgaggatgaggccatccgcatcgcc
aacgacagcatctacggcctgggcggcggggtgtggtcaggcgacgaggcgcgggcgatt
cgcgtggcgcggcgcattcgtaccgggcaggtcgacatcaacggcgggccgttcaatatg
caggcgccgtttggtggctacaagcagtccggtaacgggcgcgagaacggcaagtacggg
ctggaggagttcctggagtacaaggcactgcagctcaagcccgcgcagacggcttga

DBGET integrated database retrieval system