KEGG   Ralstonia insidiosa: ACS15_2600Help
Entry
ACS15_2600        CDS       T04471                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rin  Ralstonia insidiosa
Pathway
rin00620  Pyruvate metabolism
rin00680  Methane metabolism
rin01100  Metabolic pathways
rin01120  Microbial metabolism in diverse environments
rin01200  Carbon metabolism
Module
rin_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACS15_2600
  09102 Energy metabolism
   00680 Methane metabolism
    ACS15_2600
Enzymes [BR:rin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACS15_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANH73382
LinkDB All DBs
Position
1:2628920..2631931
Genome map
AA seq 1003 aa AA seqDB search
MTQPAARRASSRATPARKASAVPPKTSKIAKAAAKPASKPAAKATPKPNGADEANGASLG
PTSRRSSGSAAAKDQPLKEDIRFLGRLLGDVLREQEGGAAFETVETIRQTAVRFRRDGDR
QAEQELDRLLKALSREQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSMM
RALLSVADEGVSGEALRRFFDKALIVPVLTAHPTEVQRKSILDAQREIARLLAERDTPLT
TRERDRNTTTLRAHVTKLWQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEED
VASVFPRRGARGEPTPLPAFFQMGSWIGGDRDGNPFVTAETLRDAAQKQASVILAWYLEE
IHALGAELSMSTSQVDVSAELLALAEQSPDRSEHRADEPYRRALIGVYARLAATCRELTG
EDAGRHAVGPAPAYNNAEELRADIQIVIDSLAAHHGEALADARVTSLARAIDVFGFHLSS
IDLRQVSDVHEATVAELLKVAGVEGAYAALSEADKRTLLLRELQQPRLLTLPFHTYSEQT
TSEIDIFRAAREVRARYGNRIVRNYIISHTETLSDLLEVMLLQKEAGMFRANANGAGAGL
DVMVIPLFETIEDLRNAPEIMGDLLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSN
WELYKAELALVELFERKGVHLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQG
EIISSKFANPEIGRRNLETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDNAFAAYRNL
VYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRKIEDLRAIPWGFSWGQCRLL
LPGWFGFGSAVQQWLDDAGSEKARAARLATLKRMHKQWPFFANLLSNMDMVLSKADLNVA
SRYAQLCDDRKLRKAVFSRISAEFTLTEQVLASITGQSERLADNPLLARSIKNRFPYLDP
LNHLQVELLKRFRSGKAGSDDARVRRGIHLSINGIAAGLRNSG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttcctcgcgcgcgacccccgcccgcaaggcatcc
gccgtgccgcccaagaccagcaagatcgccaaggccgcagcaaagcccgccagcaaaccc
gctgccaaggccacgcccaaacccaatggcgcggacgaggccaacggtgcatcactcggt
ccaacctcacgccgctcgtcgggcagcgctgcggccaaagatcagccgctgaaagaggac
attcgcttcttgggccgcctgctgggcgacgtgctgcgtgaacaggaaggcggcgccgcc
ttcgaaaccgtcgagaccatccgccagaccgccgtgcgcttccgccgcgacggcgaccgc
caggctgagcaggaactcgaccggctgctcaaggcgctctcgcgcgaacagaccaactcg
gtggtgcgcgcgttcagctacttctcgcacctggccaacattgccgaagaccagcaccac
aaccgccgccgccgcgtgcacgcgctggcgggctccccgccgcagccgggcagcatgatg
cgcgccctgctgtcggtggccgatgaaggtgtctccggggaggcgctgcgccgtttcttc
gacaaggcgctgatcgtgccggtgctgaccgcgcacccgactgaagtacagcgcaagagc
attctggatgcgcagcgtgaaatcgcccgcctgctggccgagcgcgacacgccgctcacc
acgcgcgagcgcgaccgcaatacgacgaccctgcgcgcgcacgtgaccaagctgtggcag
acgcgcatgctgcgcaccacgcgcctgatggtggccgacgagatcgaaaacgcgctgtcg
tattaccagaccacctttctgcgcgagattcccgcgctgtaccgcgagttggaagaagac
gtcgccagcgtgttcccgcgccgtggcgcacgtggcgagccgacaccgctgccggccttc
ttccagatggggtcctggatcggcggcgaccgcgacggcaaccccttcgtcactgcagag
acgttgcgtgacgccgcgcaaaagcaggcgagcgtgatcctcgcgtggtacctggaagag
atccatgcgctgggcgccgagctgtcgatgtccacgtcgcaggtggacgtgagcgccgaa
ctgctggcgctggccgaacagtcgcccgatcgctctgagcatcgcgcggacgagccgtac
cgccgtgcgctcatcggcgtgtatgcgcgcctggccgcgacgtgccgcgagctgactggc
gaagatgccggccgccacgccgtcggccccgccccggcctacaacaacgcagaagaactg
cgcgccgacatccagatcgtcatcgattcgctggcggcgcaccacggcgaggcgctggcc
gatgcgcgcgtgacctcgctggcgcgtgcgattgatgtgttcggtttccacttgtcgtcg
atcgacttgcgacaagtgtcggatgtgcacgaagcgaccgtcgccgaattgctgaaggtg
gcaggcgtggaaggcgcgtacgcggcattgtcggaagccgataagcgcacgctgctgctg
cgcgagctgcaacagccgcgtctgctgacgctgccattccacacgtacagcgagcagacc
acgtcggagatcgacattttccgcgcggcgcgcgaggtgcgtgcccgctacggcaaccgc
atcgtgcgcaactacatcatctcgcacaccgagacgctgtctgacctgctggaagtgatg
ctgctgcagaaggaagccggcatgttccgcgcgaacgccaatggcgctggcgcgggactc
gacgtgatggtgatcccgctgttcgagaccatcgaagacttgcgcaacgcccccgaaatc
atgggcgacctgctcgccctgccgggctttgacgctgtgctggcagcgcagggcaacgag
caggaagtcatgctcggctattcggactccaacaaggacggcggcttcctcacctccaac
tgggagctgtacaaggccgagctggcgctggtggaactgttcgagcgcaagggtgtgcac
ctgcgcctgttccacggccgcggcggcacggtgggccgtggcggcggcccgacctaccag
gccatcctgtcgcagccaccgggcacggtgaacgggcagatccgcctgaccgagcagggc
gagatcatctccagcaagttcgccaaccccgagatcggccggcgcaatcttgagaccatt
gtcgcggccacgctggaagccacgctactgcccacgcgcaaccgcccgaaggggctggaa
gaattcgaggccgccatgcaggcgctgtcggacaatgcctttgccgcgtaccgcaacctc
gtctacgaaaccccgggcttcaaggactacttcttcgccaccacgcccatcaccgagatt
gcggacctgaacctcggttcgcgccccgcgtcacgcaagctgatggacaagaagcaccgc
aagatcgaagacctgcgcgcgattccgtggggcttctcgtggggccagtgccgcctgctg
ctgccgggctggttcggctttggcagtgcggtgcagcagtggctggatgacgccggcagc
gagaaggcccgcgccgcacgcctggccacactcaagcgtatgcacaagcagtggccgttc
tttgcgaacctgctgtcgaacatggacatggtgctgtccaaggccgacctgaacgtggct
tcgcgctacgcgcaactgtgcgacgaccgcaagctgcgcaaggcggtgttctcgcgcatc
tcggctgagttcacgttgaccgagcaggtgttggcgagcatcacggggcaatcggagcgg
ctggccgacaacccgttgctggcgcgctcgatcaagaaccgcttcccgtacctcgacccg
ctgaaccacttgcaggtggaactgctcaagcgtttccgttcgggcaaggccggcagcgac
gatgcgcgcgtgcggcgcggcatccacctgtcgatcaacgggattgcggcggggctgcgc
aatagcggttaa

DBGET integrated database retrieval system