KEGG   Ralstonia insidiosa: ACS15_2610Help
Entry
ACS15_2610        CDS       T04471                                 

Definition
(GenBank) copper/zinc superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rin  Ralstonia insidiosa
Brite
Enzymes [BR:rin01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACS15_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANH72288
LinkDB All DBs
Position
1:complement(2642447..2642989)
Genome map
AA seq 180 aa AA seqDB search
MKQLAIGLAVIGLMAGCASNTGSTAKAADSAMAASAVLAPKSGSTVQGSVKLAQQGDNRV
AMAVDISGLPANGMFGFHVHEKGDCSSADGMSAGGHFNPTGQQHGNPVSGPHHAGDIPML
QSDANGKAVGSITLSGVTLSPGPTSLVGHALVVHAGKDDYVTQPTGNSGGRIACGVIVAN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgcgattggactcgccgtgatcggcctgatggccggctgcgcatcgaat
accggctcgacggccaaggcggctgactcggccatggcggcttcggccgtgctggcgccc
aagagcggcagtaccgtgcaaggcagcgtgaagctggcacagcaaggcgacaatcgggtt
gccatggccgtggatatttccggcttgccggccaatggcatgttcggtttccacgtgcat
gagaagggcgactgctcctcggctgatggcatgagcgccggtggccacttcaacccgact
ggccagcaacacggcaacccggtcagcgggccgcaccatgctggcgacatcccgatgctg
caatccgatgccaacggcaaggccgtcggctcgatcaccctctccggcgtgacgctctcg
cccggcccgaccagcctggtcggccatgcgctggtcgtccatgctggcaaggatgactat
gtaacccagcccaccggcaattccggcgggcgcatcgcctgcggcgtgatcgtggccaac
tga

DBGET integrated database retrieval system