KEGG   Ralstonia insidiosa: ACS15_3140Help
Entry
ACS15_3140        CDS       T04471                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rin  Ralstonia insidiosa
Pathway
rin00473  D-Alanine metabolism
rin00550  Peptidoglycan biosynthesis
rin01100  Metabolic pathways
rin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACS15_3140
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACS15_3140
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ACS15_3140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rin01011]
    ACS15_3140
Enzymes [BR:rin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ACS15_3140
Peptidoglycan biosynthesis and degradation proteins [BR:rin01011]
 Precursor biosynthesis
  Amino acid ligase
   ACS15_3140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ANH71691
LinkDB All DBs
Position
1:complement(3188533..3189528)
Genome map
AA seq 331 aa AA seqDB search
MSTGPFVPHPTIDPKSLGKVGVLLGGRSAEREISLLSGNGVLAALRSRGVDAHPFDPGLQ
PVAELAKQGFDRVVISLHGRFGEDGTIQGLLEQFGIPYTGSGVLASALAMDKEATKRQWQ
THGLPTPDFVMLKADTDWQAVADRLGLPLIVKPAREGSSIGLTKVTSAAELPAAYEKAAR
LDRDVMAEQFIDGDELTCPVIGEGESATALPLIRIVAPQANYDYQNKYFTDDTRYECPAP
IPADVAAKVQSLVVQAYRGLGCRGWGRADIMLRKSDNAPFLLEMNTSPGMTGHSLVPMGA
RAAGISYEDFVLQLAASASLELHASTDWKPE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggtccgttcgttccgcatccgacgattgatccgaagtccctcggcaaggtc
ggcgtgctgctgggtggccgttcggccgagcgggagatttctctgctgtcgggcaacggt
gtgctggccgcgctgcgttcgcgtggcgtggatgcgcatccgttcgatccgggcctgcag
ccggtggctgagcttgccaagcagggttttgaccgcgtggtgatttcgctgcacggccgc
tttggtgaagacggcacgatccaggggctgctcgaacaattcggcattccctataccggc
agcggcgtactcgcgtctgcgctggcaatggacaaggaagccaccaagcgccaatggcag
acccacggcctgcccacgcccgacttcgtcatgctcaaggccgacaccgactggcaagcc
gtggccgaccgcctgggcctgccgttgatcgtcaagccggcgcgcgaagggtcgtcgatc
ggcctgaccaaggtcacgagcgctgccgaactacccgccgcctacgaaaaggccgcgcgc
ctggaccgtgacgtgatggccgagcagttcatcgacggcgacgagctgacctgccccgtg
atcggtgaaggcgagagcgcgaccgcgctgccgctgatccgcatcgtcgcgccgcaggcc
aactatgactaccagaacaagtacttcaccgacgacacgcgctacgaatgcccggcaccg
attccggctgacgtggccgccaaagtgcagtcgctggtggtgcaggcgtaccgcgggctg
ggctgccgcggctggggccgcgccgacatcatgctgcgcaagtccgacaacgcgccgttc
ctgctggagatgaacacgtcgccgggcatgaccggccattcgctggtgccaatgggcgcg
cgcgctgcgggcatcagctacgaagatttcgtgttgcaactggcggctagcgcgtcgctg
gagctgcacgcgagcactgattggaaacctgagtaa

DBGET integrated database retrieval system