KEGG   Ralstonia insidiosa: ACS15_3870Help
Entry
ACS15_3870        CDS       T04471                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase family protein
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
rin  Ralstonia insidiosa
Pathway
rin00250  Alanine, aspartate and glutamate metabolism
rin00310  Lysine degradation
rin00350  Tyrosine metabolism
rin00650  Butanoate metabolism
rin00760  Nicotinate and nicotinamide metabolism
rin01100  Metabolic pathways
rin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACS15_3870
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACS15_3870
   00310 Lysine degradation
    ACS15_3870
   00350 Tyrosine metabolism
    ACS15_3870
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACS15_3870
Enzymes [BR:rin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     ACS15_3870
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     ACS15_3870
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     ACS15_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TetR_N
Motif
Other DBs
NCBI-ProteinID: ANH73921
LinkDB All DBs
Position
1:3919517..3921019
Genome map
AA seq 500 aa AA seqDB search
MTRTDLPNAPAAPIALKDPGLWRTQAFLAGTWADADDGATRDVTDPATGRTIGTVPGMGA
AETRRAIDAAQVAQRAWRKVPARERSKILRKLADLMMDHQQDLAAILTAEQGKPLPEAAG
EIAYAASFIEWFAEEARRVYGDTIPAPQSDRRIVVTKEPIGVTAAITPWNFPIAMMTRKV
GPALAAGCSMVVKPALETPYSALAFAELAARAGVPAGLLSVITGDSQAIGGELTSNTIVR
KLSFTGSTGVGKLLMRQCAEDIKKLSLELGGNAPFIVFDDADVDAAVEGAMIAKYRNAGQ
TCVCANRFYVQRGIYDTFAAKLADAVRALRVGNGTEPGVQQGPLIHMRAMDKVRQHLDDA
IAQGARVLVGGKPHALSAQGGAFFEPTVVVDAKPGMLVAHEETFGPLAALIPFDTEDEAV
AAANDTEFGLAAYFYTRDLGRAWRVSEALESGMVGVNTGLISTAEAPFGGVKQSGLGREG
SKYGIDEYLEIKYINMAGLG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactgatttgccgaacgcaccggccgcaccgatcgcgctcaaagacccgggc
ctgtggcgcacgcaggcgtttcttgccggcacctgggccgatgccgatgatggcgccacg
cgcgatgtgaccgaccccgccaccggccgcaccatcggcaccgtgcccggcatgggcgcg
gccgagacgcgccgcgccatcgacgccgcacaggttgcgcagcgcgcctggcgcaaggtg
ccggcgcgtgagcgttcgaagatcttgcgcaagctggccgacctgatgatggatcaccag
caggacctcgctgccatcctcacggccgagcaaggcaagccgctacccgaagccgctggc
gagatcgcttacgccgcctcgttcatcgagtggtttgccgaagaagcgcgccgcgtctat
ggcgacacgattcccgcgccgcagagcgatcgccgcatcgtcgtgaccaaggagccgatc
ggtgtgacggccgctatcacgccgtggaatttcccgatcgcgatgatgacgcgcaaggtg
ggcccggcgctggcggcgggctgctcgatggtggttaagcccgcgcttgagacgccctat
tccgcgctggcctttgccgagttggctgcgcgtgcgggtgtgcctgcgggtttgctctcc
gtcatcacgggggactcgcaagccattggcggcgagctgacctccaacaccatcgtgcgc
aagctgagcttcacgggctccacgggtgtcggcaagttgctgatgcgccagtgcgcggaa
gacatcaagaagctatcgctcgagctgggtggcaacgcgcccttcatcgtgtttgacgat
gcggatgtcgatgccgccgtggaaggcgcgatgatcgccaagtaccgcaacgccggccag
acctgtgtgtgcgccaatcgcttctacgtacagcgcggtatctacgacacgtttgccgcc
aagctggccgatgcggtgcgcgcgctgcgcgtgggcaatggcaccgagcccggcgtgcag
cagggcccgctgatccacatgcgtgcgatggacaaggtgcgtcagcatctggacgatgcc
atcgcacaaggtgcccgcgtgctggtaggcggcaagccgcatgcgctgtccgcacaaggc
ggtgcgttcttcgagccgaccgttgtggtcgatgccaagccgggcatgctggttgcgcat
gaagagaccttcggcccgctggcggcgctcatccccttcgacaccgaagacgaagccgtg
gccgccgccaacgacaccgagttcggcctggccgcgtacttctacacgcgtgatctgggc
cgcgcgtggcgcgtgtcggaggcgctggagtcgggcatggtcggtgtcaacaccgggctg
atctcgacggccgaagcaccgttcggcggcgtcaaacaatcgggcctgggccgcgaaggc
tccaagtacggcatcgacgagtacctggagatcaagtacatcaacatggctgggctcggt
taa

DBGET integrated database retrieval system