KEGG   Ralstonia insidiosa: ACS15_5655Help
Entry
ACS15_5655        CDS       T04471                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rin  Ralstonia insidiosa
Brite
KEGG Orthology (KO) [BR:rin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACS15_5655 (ahpF)
Enzymes [BR:rin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACS15_5655 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Glutaredoxin HI0933_like AlaDh_PNT_C FAD_binding_3 DAO FAD_binding_2 Thi4 K_oxygenase NAD_binding_8 baeRF_family10 FMO-like
Motif
Other DBs
NCBI-ProteinID: ANH75956
LinkDB All DBs
Position
2:1798501..1800075
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAEQSSMIVLTEQRDAAE
RAPSFLIRRTGSDVSVRFAAIPTGHEFTSLVLALLQVGGYAPKLEADVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGGMYQDEIEQRKIMAVPTVFLNGET
FGTGRMGVEEILAKIDTGAAARDAEKLAAKEPYEVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLAIENFISVSETEGPKFAAALEQHVRQYEVDIMNAQRAVKLTPADAPG
GFAEVTLANGAVLKSRSIILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVSHVTLLEFAEELKADAVLVRKLKSLPNATIVTNAQTSEITGN
GEKVNGLRYKDRVGGVEHEIALEGVFVQIGLVPNTEWLDGAVERNRFGEIVVDARGQTSA
EGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgctgatgtcaaggcccaactgaaggcctacctcgaacgcctcgtgcagccc
attgagctggtcgccaacgtcgatgacagcgagggctcccgcgacatgatggacctgctg
cgtgatgtggccgagcagtccagcatgattgtgctgaccgaacaacgtgacgcggctgag
cgtgcgccgtcgttcctgatccgccgcaccggctctgatgtgagcgtgcgttttgccgcg
atcccgaccggccacgagttcacctcgctggtgctggcgctgctgcaagtgggtggctat
gcccccaagcttgaagccgacgtcatcgaacagattcgcaatatcgaaggggatttccgc
ttcgagacctacatgtcgctcacgtgccagaactgcccggacgtggtccaggcgctgaac
gtgatgtccgtgatcaacccgcgcatccagcacgtcgccattgacggcggcatgtaccag
gacgaaatcgagcagcgcaagatcatggcggtgccgacggtgttcctgaacggtgaaacc
ttcggcacgggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgca
gcgcgtgacgctgaaaagctcgccgccaaggagccgtatgaagtgctgatcgtgggcggt
ggccctgctggcgcggctgcagccgtgtacgcagcacgcaagggtgtgcgcaccggcgtg
gtggccgagcgctttggtggtcaggtgctggacacgttggccatcgagaacttcatctcc
gtgtctgaaaccgaagggccgaagtttgccgccgcgctggagcagcacgtgcgccagtac
gaggtcgacatcatgaacgcgcagcgcgcggtcaagctcacgccggctgatgcgccgggc
ggctttgccgaggtgacgctggccaacggtgcggtgctcaagagccgctcgatcatcctg
tcgactggtgcacgctggcgcaatgtgaacgtgcccggcgagcaggaatacaagaacaag
ggcgtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtg
attggcggtggtaattctggtgtggaagccgccatcgacctggcgggtctggtcagccac
gtcacgctgctggagtttgctgaagaactgaaggcagacgccgtgctggtgcgcaagctg
aagagcctgccgaacgcgaccatcgtcaccaacgcgcagaccagcgagatcaccggcaac
ggcgagaaggtgaacggcctgcgctacaaggatcgcgtgggcggcgtcgagcacgagatc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctggatggc
gcggtggagcgcaaccgcttcggcgagatcgttgtcgatgcgcgcggccagaccagcgcg
gaaggcgtgttcgctgcaggcgatgcgaccaccacgccgtacaagcagatcatcatcgca
acaggtgatggtgccaaggctgcgctgtcggcgttcgatcatctgatccgcgtgccgttg
gctgaagctgcctga

DBGET integrated database retrieval system