KEGG   Candidatus Riesia pediculicola: RIEPE_0479Help
Entry
RIEPE_0479        CDS       T01218                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00473  D-Alanine metabolism
rip00550  Peptidoglycan biosynthesis
rip01100  Metabolic pathways
rip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RIEPE_0479
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RIEPE_0479
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RIEPE_0479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rip01011]
    RIEPE_0479
Enzymes [BR:rip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RIEPE_0479
Peptidoglycan biosynthesis and degradation proteins [BR:rip01011]
 Precursor biosynthesis
  Amino acid ligase
   RIEPE_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADD79621
UniProt: D4G8Q9
LinkDB All DBs
Position
complement(453604..454530)
Genome map
AA seq 308 aa AA seqDB search
MRYKELKVAILYGGNSSERTISLKSGKNIANSLKDLGIQSDLIDTKYQFSIDRIASVRYD
KIFIALHGKNGEDGTIQRILDKFKMNYTGNGFYSSFIGTHKILTKKIWFSLKLPTAPFFY
INKKSFFMQPRSAISSVFKKIGFPLIIKPDSEGSSIGVRKAFSLKEAERILVESFKYDRY
IIIEKYIIGPEYTVSILNPYYILPSIKIDLYGDEIFSYGNKYDKFVEYICPGGSSQSKEI
LIKKIALAAYKAIGCFGLSRVDLKQNYDGNFYLLEINTVPGMTDRSLVKIAAEQSGMSFS
KLVGKILY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagatataaagaattaaaagttgcaatactatatggtggaaattctagtgaaagaacg
atttctttaaagtctggaaagaacatagcaaattctttaaaagacctcggaattcaatcg
gatctgatcgataccaaataccaatttagtatcgatcgcatcgcttctgttcggtatgat
aaaattttcattgcattgcatggaaaaaatggagaagatggaacaattcaaagaatatta
gacaaattcaagatgaattatacaggaaatggtttttactcttcttttataggaacacac
aaaattttgaccaaaaaaatatggttttctttaaaattaccaacagctccttttttttat
attaataaaaaatctttttttatgcaacctagatctgcaatatcttctgtttttaaaaaa
attggatttcctttaataattaaacctgactcagaaggatccagtataggagtaagaaaa
gcgttctctttgaaagaagccgaaagaattctggtagaatcttttaagtatgatcggtac
attattatagaaaaatacataattggtccagaatatactgtatcgatcttaaatccgtac
tacatattaccctcgattaaaattgatctatatggagatgaaatattttcttatggaaat
aaatatgataagttcgtagagtacatttgtccaggaggttcaagtcaatcaaaagaaatt
ctaatcaaaaaaattgcattagctgcttataaagcaataggttgttttggattatccaga
gtagatctcaagcaaaactatgacggaaacttctatttattagaaattaacactgttcca
ggaatgactgatcggagtttagttaagattgccgctgaacaatcaggcatgtctttctca
aaattagtaggaaaaattctttattaa

DBGET integrated database retrieval system