KEGG   Rhizobium pusense IRBG74: BN877_I0099
Entry
BN877_I0099       CDS       T02867                                 

Definition
(GenBank) Penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I0099
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I0099
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rir01003]
    BN877_I0099
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I0099
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN877_I0099
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I0099
Glycosyltransferases [BR:rir01003]
 Polysaccharide
  Bacterial polysaccharide
   BN877_I0099
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BN877_I0099
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: CDI07018
UniProt: U4PPI4
LinkDB
Position
complement(106274..108586)
AA seq 770 aa
MAGKGRSRERVEPSFGDFHESGDDLRLDASERISGTAKQSPKKPKQASRRPKTTKNEKRA
RSTGRGATGFIRSLVYWCIVLGIWGGIGIAGLVLYYGARMPSASSWSIPERPPNVKIVSV
NGSVLANRGTTGGEALALEDMSPYIPQAVMAIEDRRFYSHFGVDPLGLGRAIVTNVLTGR
TVQGGSTLTQQLAKNLFLSPDRTLERKVQEVLLSFWLEHKFTKDQILAMYLNRVYFGSNA
YGVEAASRRYFNKSARDVNLGEAAMLAGLLKAPSRLSPARDPQAAEERAQVVLQSMRDVG
FITDDEIKTAMSQPPTKAKRFWSGAEHYAADMVLEEVRGLVGEVKQDIVVDTTIDPDLER
DAEKALTHVLQGDGKKQGASQAALVSIDGTGAIRAVVGGADYAESQFNRAAKAKRQPGSA
FKPFVYVAALESGLTPYTIRNDGPVRIGNWTPENYEKKFRGEVTLATALANSLNTIAAQL
VMEVGPERVTQVAHRMGIESELQNNASIALGTSEVSLMELTASYAPFMNGGYKATPHIVK
RITDADGKVLYENKYDNPPRVLSEEIAATMNGMLSRVITEGTGKAARLQGWQAAGKSGTT
QSFRDALFVGYTSNLTTGVWFGNDDGTSMKKVTGGGLPARAWKEFMTAAHSGLSPSPLFG
LGAGGVPPLMDMQQPAPENAPSSIGDIISNALGGGTTDNRAYPAAPASPTPNQPDGQSGG
LTPPANIPSRDIEPRYSAGNGPVPPADIGGEAPDASGPKQTTLLDILMGR
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcaggcaagggtagatcacgcgaacgggtagaaccctctttcggggatttccacgag
tccggtgacgatctgcgtcttgacgccagcgagcgcatcagcggcactgcaaaacagtcg
ccgaagaaaccgaaacaggcttcacgccgacccaagacgacgaaaaacgaaaagcgcgcc
cgcagcacaggtcggggggcgacgggtttcatccggtccctcgtctattggtgcatcgtg
ctgggcatttggggcggtatcgggattgccggacttgtgctttattatggcgcgcgcatg
ccgagtgccagcagctggtccattccagaacgtccgccgaatgtgaagatcgtttccgtg
aatggcagcgtgcttgcaaaccgcggcacgaccggcggcgaggcgctcgcgctggaagac
atgtcgccctatattccacaggctgtgatggcgattgaggaccggcggttttattcccat
ttcggggtcgatccgcttggtctcggacgtgccatcgtcacgaatgtgctgacggggcga
accgtgcagggcggctcgacactgacgcagcagctggcgaaaaaccttttcctttcgccg
gacaggaccctcgaacgcaaggttcaggaagtgctgctgtccttctggctggagcacaag
ttcaccaaagatcagatcctggcgatgtacctcaatcgcgtctatttcggatccaacgcc
tatggcgtcgaggcggcctcgcggcgctacttcaacaaatccgcccgcgacgtcaatctg
ggcgaagcggcaatgctcgccgggcttctcaaagcgccctcgcgcctttcgccggcacgg
gacccacaggcagcggaagaacgggcgcaggtcgtgctgcaatccatgcgcgacgtcggt
ttcattaccgatgatgagatcaagaccgccatgtcgcagccgccgaccaaagcgaaacgc
ttctggtccggtgccgaacattacgccgccgacatggtgctggaagaggtgcgcggcctg
gttggcgaggtcaagcaggatatcgtcgtcgatacgacaatcgatcccgatctcgagcgc
gatgccgaaaaggcgctgacccacgtgctgcagggcgacggcaaaaaacagggcgcctcc
caggcggcactggtttccatcgatggtacgggcgcgatcagggccgtggtgggcggtgcg
gattatgccgaaagccagtttaaccgcgccgccaaggcaaaacgccaacccggctcggca
ttcaagcccttcgtctacgtcgccgccctcgaatccgggcttacgccctataccattcgt
aatgacgggcctgttcgtatcggcaactggaccccggaaaattatgagaagaaatttcgc
ggcgaagtgacactggccacagcgctggccaactccctgaacaccatcgccgcccagctg
gtgatggaggtcggtcccgagcgggtgacacaggtggcgcatcgcatgggcatcgaatcg
gagctgcagaacaatgcctccatcgcgctcggcacttcggaagtgtcgctgatggaactg
acagcttcttatgctcccttcatgaatggcggctataaagccacgccgcacatcgtgaag
cgtatcaccgatgccgatggcaaggtgctttatgaaaacaaatatgacaatccgccacgg
gtgctgagcgaagaaattgccgccacgatgaacggcatgctgtcgcgcgtcatcaccgaa
ggtaccggcaaggccgcgcgcctgcagggctggcaggcagcggggaaatccggcaccact
cagtctttccgcgatgcgctctttgttggctatacgagcaatctgacgaccggcgtctgg
tttggaaacgacgacggcacctccatgaaaaaggtcacgggcggcggccttcctgcaagg
gcgtggaaagagttcatgaccgcggctcattccggtctttcgccttcgcccctcttcggt
cttggtgcaggcggcgtgccgccgctcatggatatgcagcaaccggcgccggagaatgcg
ccctcctccattggcgacatcatttccaacgcgctgggcggcggaacgactgataatcgc
gcctatcccgcggcgccggcatcacccacaccgaatcagccagatgggcagtcgggaggg
ctgacgccgccggctaatattccttcgcgggatatcgaaccccgttattccgccggcaac
ggccctgtgccgccggccgatattggcggtgaagcgcctgacgcgtcgggaccgaaacaa
accaccctgctcgacattctgatgggtcgctga

KEGG   Rhizobium pusense IRBG74: BN877_I0919
Entry
BN877_I0919       CDS       T02867                                 

Definition
(GenBank) putative penicillin-binding protein (mrcA-like)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I0919
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I0919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rir01003]
    BN877_I0919
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I0919
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN877_I0919
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I0919
Glycosyltransferases [BR:rir01003]
 Polysaccharide
  Bacterial polysaccharide
   BN877_I0919
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BN877_I0919
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: CDI07833
UniProt: U4PRT7
LinkDB
Position
complement(902640..904832)
AA seq 730 aa
MQEEKDDKKGRKKRHILLRIDSFIDSGLWTAAARLVDFWEDITIASRKLHVRGWKKLLVN
LTCDALTFGTAGSVVLLALAMPAFEETKKDWRYRGDFAVTFLDRYGNTIGHRGIIHEDSV
PIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNL
FLTNERSLERKIKEAFLALWLETNMSKKEILSLYLDRAYMGGGTFGAAAAAQFYFGKNLT
DVTLSESAILAGLFKAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVVGARRNPAT
VIDREDVKAPDYFLDWAFDEVQRLAAAGKFKDHTVVVRTTIDAGLQQAAEQAMEMGLREL
GEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQFNRATAALRQPGSSFKVYTYSAAMEKG
MKPETLISDAPVTWRGWSPQNYGRSYAGKVTLQMALAKSYNTVPVRLAKDVLGTQVIVDT
AKAMGVATPLRSDKTIPLGTSEVTVMDQATAYAVFPADGMQSRRHGIEQVLDYEGNVLYD
FSHDEPPAKRVLSVDANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYV
GFTGNYTTAVWFGNDDFTPMNNMTGGALPAMTFKRLMDYAHQGMELRPIPGIQNPLPTGA
RPQPSAEVAAAASSTPALPALTRPRSLSAEATRVIRSIGRKMKEATALNVTTQKVADAAI
RDSKDEAARR
NT seq 2193 nt   +upstreamnt  +downstreamnt
gtgcaggaagaaaaagacgataaaaaaggccgcaaaaaacggcatatcctgctccggatc
gatagcttcatcgactccggcctgtggacggctgcggcaaggctggtggatttctgggaa
gatatcaccatcgcctcgcgcaagctgcatgtccgcggctggaagaagctcctcgtcaat
ctcacctgcgacgcgctgacctttggaacggcgggatcggtcgtgcttctggcgcttgcc
atgcccgctttcgaggaaaccaagaaggactggcgttatcgcggtgacttcgcagtcacc
ttcctcgaccgatacggcaacaccatcggtcatcgcggcatcatccatgaagacagcgtg
ccgatcgaccagatgcctgatcatttcatcaaggcggtgctggcgaccgaggaccggcgc
tttttcgaccatttcggtatcgattttatcggccttgcccgcgccatgagcgaaaacgcc
cgcgccggcggcgtggtgcagggcggctcgacgctgacgcagcagctcgccaagaacctc
ttcctcaccaatgaacgctcgctggagcgcaagatcaaggaagccttcctcgcgctgtgg
ctagagaccaacatgtcgaagaaggaaatcctgagcctttatctcgaccgcgcctacatg
ggcggcggcacctttggtgctgctgcggccgcgcagttttatttcggcaagaacctcacc
gacgtgacgctttcggaatccgccattctggccgggcttttcaaagcgccagcgaaatat
gcaccgcatgtcaaccttccggcggcgcgtgcccgcgcgaacaccgtgctttccaacctc
gtgcagagcgggctgatgaccgaggggcaggtggtcggcgcgcgccgcaaccccgccacc
gtcatcgaccgcgaagacgtgaaggcgccggattatttcctcgactgggcttttgacgaa
gtgcagcggctggccgccgcgggcaagttcaaggatcacaccgtcgtcgtccgcaccacc
atcgacgccggcctgcaacaggcggccgaacaggcgatggaaatgggcctgcgcgaactc
ggcgaagggtatcgcgtcaagcagggcgcgatggtgatgatcgaaaatggcggtggcgtg
cgtgccatggtgggcggccgcgactatggcgaaagccagttcaaccgcgccacggcggcg
ctgcgccagccgggttcctccttcaaggtctatacctattcggccgccatggaaaaaggc
atgaagccggaaacgctgatttccgacgcgccggtaacctggcgcggctggtcgccgcag
aattacggccgctcctatgcgggtaaggtgacgctgcagatggcgctcgccaagtcctac
aataccgtgccggtccggctcgccaaggacgtgctcggcacgcaggtcatcgtcgatacc
gccaaggcgatgggtgtcgccacgccgctgcgcagcgacaagaccattccgctcggcaca
tcggaagtgacggtaatggatcaggccaccgcctatgccgttttcccggctgacggcatg
cagtcgcgccgccacgggatcgagcaggtgctggattacgagggcaatgttctctacgat
ttcagccatgacgagccgcccgccaaacgcgtgctgtccgtagacgccaattcgaagatg
aaccagatgctggtgaccattcctgtgatgggtacggcgcggcgcggtgcgcttgacaat
ggcatcgtttccggcggcaagaccggcacttcacaggcctatcgcgatgcctggtatgtg
ggctttaccggcaactacaccaccgccgtctggttcggtaacgacgatttcacgccgatg
aacaacatgaccggcggtgcgctgcccgccatgaccttcaagcggctgatggactatgcc
catcagggcatggagctgcgccccatccccggcatccagaacccgctgccgaccggcgcc
cgaccgcagccttctgcggaagtggcagccgcagccagcagcacacccgccctgccggcc
ctcacccgtccccgttcgctctcggccgaggcgacccgtgtaatccgctccatcgggcgg
aagatgaaggaagccacggcgctgaatgtgacgacgcagaaggtggcggatgccgccatc
cgcgatagcaaagacgaagccgcgcggcgttag

KEGG   Rhizobium pusense IRBG74: BN877_I1323
Entry
BN877_I1323       CDS       T02867                                 

Definition
(GenBank) putative membrane carboxypeptidase/penicillin-binding protein; putative exported protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I1323
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I1323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rir01003]
    BN877_I1323
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I1323
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN877_I1323
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I1323
Glycosyltransferases [BR:rir01003]
 Polysaccharide
  Bacterial polysaccharide
   BN877_I1323
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BN877_I1323
SSDB
Motif
Pfam: Transgly Transpeptidase PCB_OB
Other DBs
NCBI-ProteinID: CDI08231
UniProt: U4Q6M2
LinkDB
Position
1290095..1292542
AA seq 815 aa
MIRLIGYFFGLASVLFLCAAAAGAIYLHGVTKDLPDYAVLSTYEPPVTTRVHAGNGALMA
EYAHEKRLFLPIQAIPDRVKAAFLSAEDKNFYNHPGVDVWGLGRAILVNIQNFGSGRRPV
GASTITQQVAKNFLLTNDQTIDRKLKEAILSFRIEQTYSKDKILELYLNEIFFGLNSYGI
AGAALTYFNKSVTELTIAETAYLASLPKGPANYHPIRREKAALERRDWVIDRMAENGYIT
ASDAADAKKQPLGVNLRRGGAHIFASDYFAEEVRRQIVEKYGEEALLEGGLSVRTSFDPQ
IQMEARKALQDGLVQYDERRGFRGPIEKIETAGDWTAALAKVKGLRDVPEWKVAVVLAVA
ADGVDIGIQADPDAEDGDKRTRGHISAENMRWAYRDAAGKKATAKSPVGVLTVGDVIYAQ
PLSSSGNEYRLRQPPKVQGGMVVMDPHTGRVLAMVGGFSYAQSEFNRSTQAMRQPGSSFK
PFIYAAALDNGYTPASVILDAPIEVVSGGQVWKPQNYGGGSAGPSTLRLGIEKSRNLMTV
RLAQDMGMNLVAEYAERFGIYDKMPPLLSMSLGSGETTVMRMVSAYSVIANGGKQIKPTL
IDRIQDRYGKTIFRHEERACEGCNATSWQNQDEPVIVDNREQVLDPMTAYQTTSMLEGVV
QRGTAAGKIKVDLPVAGKTGTTNDEKDAWFVGYTPDMVAGLYIGFDSPAPLGRGGTGGSL
SAPIFGEFIADAAKHLQPSKFIVPAGMNFVAVNRKTGMAAAEGEPDTIMEAFKPGTGPAD
SFSVIGAEGYMSQEDILKTSPQAQQAITGGGGGLY
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgatcagactgattggatattttttcggcttggccagcgtgcttttcctgtgcgccgcc
gccgccggtgcgatttatttgcacggcgtgacgaaggacctgccggattacgcagttctg
agcacctatgaaccgccggtcacgacccgcgtgcatgcgggcaatggtgcgcttatggcg
gaatatgcccatgagaagcgcctgttcctgccgatccaggccattcccgaccgggtgaag
gccgccttcctgtccgcggaagacaagaatttttacaatcaccccggcgtcgatgtgtgg
ggcctcggccgtgccattctcgtcaatatccagaatttcggctccggccgccgtccggtg
ggcgcatccaccatcacccagcaggtcgcgaagaacttcctgctgacaaacgaccagacc
atcgaccgcaagctcaaggaagccattctttccttccgcatcgagcagacctattccaag
gacaagattcttgagctttatctcaatgagatcttcttcggcctgaattcctacggcatc
gccggcgcggcgctcacctatttcaacaagtcggtgacggaactgaccattgcggaaacc
gcctatctggcgtcgctgccgaaaggcccggccaattaccatcccatccgccgcgaaaag
gcggctctcgagcgtcgcgactgggtgatcgaccgcatggccgaaaacggctatatcacg
gcctccgacgccgcagacgccaagaaacagccgcttggagtgaacctgcgccgcggtggc
gcgcatatcttcgcgtccgactactttgccgaggaagtccgccgccagatcgttgagaaa
tacggcgaggaagcacttctcgaaggcggcctttccgttcgcacttcctttgatccccag
attcagatggaggcccgcaaggcgcttcaggatggtctggtgcagtatgatgagcgtcgc
ggtttccgtgggcccatcgaaaagatcgagacggccggcgactggacggctgcgcttgcc
aaggtcaagggcttgagagacgttccggaatggaaggtcgcggtcgtgcttgcggttgcc
gcagatggtgtcgatatcggcatccaggccgaccccgacgcggaagatggcgacaagcgc
acgcgcggtcacatctctgcggagaacatgcgctgggcctatcgtgacgcggcaggcaag
aaagccaccgccaagtctccggttggcgtcctgacagtcggtgacgtcatctatgcgcaa
ccgctttccagctccggaaatgaatatcgcctgcggcagccgcccaaggtgcagggtggc
atggtggtgatggacccgcataccggccgcgttctggccatggtcggcggtttctcctat
gcgcaatcggagttcaaccgctcgacgcaggcaatgcgtcagcccggttcctcgttcaag
ccgttcatctatgcagcggcgctcgacaatggctatacgccggcatcggttattctcgat
gcgcccattgaggtggtgtcgggcggccaggtctggaaaccgcagaattacggcggcggt
tctgcaggtccctcgaccctgcgcctcggcatcgaaaagtcccgtaacctcatgaccgtg
cgtctggcgcaggacatgggcatgaatctggtggcggaatatgccgaacgcttcggcatc
tacgacaagatgccgccgcttctctccatgtcgctcggttcgggtgaaaccaccgttatg
cgtatggtttcggcctattcggtcatcgccaatggtggcaagcagatcaagccgacgctg
attgaccgcattcaggaccgttacggcaagacgatattccgccatgaggagcgcgcctgc
gaaggttgcaacgctaccagctggcagaaccaggatgagcctgtgatcgtcgacaaccgc
gaacaggttctggacccgatgaccgcttatcagaccacctccatgctggaaggtgtcgtg
cagcgcggtacggccgcaggcaagatcaaggtcgatctgccggttgccggcaagacgggc
accaccaatgatgaaaaggatgcctggttcgtcggttacaccccggacatggtcgccggc
ctgtacattggtttcgactcgcccgcaccgctcggtcgcggtggtaccggcggctcgctg
tctgcgccgattttcggtgaattcatcgccgatgcggccaagcatctccagccgagcaag
ttcatcgtgcctgcaggcatgaacttcgttgccgtcaaccgcaagaccggcatggcggca
gcggaaggcgaaccggacacgatcatggaagcctttaagcccggcacaggcccggccgat
agcttctcggtcatcggtgctgaaggctacatgtcgcaggaagatattctgaaaacctcg
ccgcaggcgcagcaggccatcaccggcggtggcggcggcctttattga

KEGG   Rhizobium pusense IRBG74: BN877_II0643
Entry
BN877_II0643      CDS       T02867                                 

Gene name
pbpC
Definition
(GenBank) Penicillin-binding protein 1C (PBP-1C)
  KO
K05367  penicillin-binding protein 1C [EC:2.4.1.129]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_II0643 (pbpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rir01003]
    BN877_II0643 (pbpC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_II0643 (pbpC)
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN877_II0643 (pbpC)
Glycosyltransferases [BR:rir01003]
 Polysaccharide
  Bacterial polysaccharide
   BN877_II0643 (pbpC)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BN877_II0643 (pbpC)
SSDB
Motif
Pfam: Transgly BiPBP_C Transpeptidase
Other DBs
NCBI-ProteinID: CDI10442
UniProt: U4QDB1
LinkDB
Position
linear:complement(650489..652567)
AA seq 692 aa
MRRKKAVIVGFVVAALLIGGAAFGLDALDKAYPPPLEAARQRSFEVLDRDGKLLRAFATP
DGRWRLDTTAAEVDPQFLRMLVAYEDQRFYDHHGIDPWALLRSAWQLVSNGRIVSGASTL
SMQVARLVEPRADRSFSAKLLQALRAIQIERRLSKADILDLYLNIAPYGGNLEGIRAASL
AWFGKEPGRLDTAEAALLVALPQLPERRRPDRYPEAARQARERVLQRLAVERVVGEGEAE
RATLAGVPTSRRDLPALAPHMAAAARAKFPNAAEIRSTLKLSIQRELEGVARHAAGKIGD
KVSVAIVMADAESGDILAEVGSADYLDTARRGFVEMSRAVRSPGSTLKPFIYGLAFEDGL
IGQETIIEDRPADFSGYRPRNFDMHYQGDVSIRQALQLSLNVPAVKLLDSVSPSALMVRF
RRSGVTLALPANEAPGLAIALGGAGISLVDLVQLYAGLTGGDGPVRLGDGVRSAPERLEG
DRLFSDAAIWNVSDILSGVLPPLGMKQRGIAYKTGTSYGYRDAWSIGYDGRHVVGVWVGR
ADNGAVPGIAGYATAAPILFEAFEKSGVAITPMPTAPSGVARVSVADLPANQRRFTTTAN
GLLSASRRESAPRIVYPPEGARVELSGQSGISPLVLKLQGGRAPFRWLANGLPLPDASHR
RNSEWRPEGQGFSTLTVIDADGRASSVRIFVE
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgagacggaaaaaagctgtcatcgtcggcttcgttgtggccgcattgcttatcggcggt
gcggccttcggtctcgatgcgctggacaaggcctacccgccgccgctcgaggcagcgcgg
cagcgatccttcgaggtgttggaccgcgacggcaagttgctgcgtgccttcgcaacaccg
gatggccgctggcggctcgacaccacggcggccgaggtcgatccgcagttcctgcggatg
ctggtcgcctatgaggaccaacgcttttacgaccatcacggtatcgatccctgggccttg
ctgcgttccgcgtggcaactggtgagcaacggccggatcgtatccggcgcctcgacgctt
tccatgcaggtggcgcggctggtcgagccgcgcgccgaccgctccttctcggcaaagctt
cttcaggccctgcgggctattcaaatcgaacggcggctcagcaaggcggatatcctcgat
ctttatctgaatatcgcgccctatggcggtaatctcgaaggcatacgcgcggccagcctc
gcctggttcggcaaggagccgggaaggctcgacacggccgaagcggcccttctggtcgcc
ctgccgcaattgccagaaaggcgtcgcccggacaggtatcccgaggcggcgagacaggca
agggaacgggtcttgcagaggcttgccgtcgaacgtgtcgtgggtgagggcgaagccgaa
cgggcgacgcttgcgggcgttccgaccagccggcgcgatctgccggcgctagcaccgcac
atggctgctgccgcgcgtgcgaaattccccaatgctgcggaaatacgctcgactctgaag
ctttcgatccagcgggaactggaaggcgtggcgcgccatgcagcaggaaaaatcggcgat
aaggtatccgtcgccatcgtcatggccgatgcagagagcggggatattctggcggaggtc
ggctcggcggattatctcgataccgcgaggaggggtttcgtggagatgagccgcgcggtg
cgctcgcccggatcgaccctcaagccattcatttatggcctcgcctttgaggatggcctg
atcggtcaggagaccatcatcgaggatcgcccggctgatttttccggttaccggccgcgc
aatttcgacatgcattatcagggcgatgtcagcatcaggcaggcgctgcaactgtcgctc
aacgtgcccgccgtgaaattgctcgactcagtgagcccatcggcgctgatggtgcggttc
cggcggtctggcgtcacactcgcgttgcctgccaacgaagcacccgggctcgccattgct
ctcggaggcgccggtatttcgcttgtcgatcttgtccagctttatgccgggctaacaggt
ggcgacggtccggtacgcctcggtgatggcgtccgctccgccccggaacgactggaaggc
gaccgattgttttccgatgccgcaatctggaacgtttcggacatcctgtccggcgtgctg
ccgccactcggcatgaaacagcgcggcatcgcctacaagaccggcaccagctacggttac
cgcgacgcctggtcgatcgggtatgacgggcggcacgtggtcggcgtctgggtcggccgc
gccgataacggcgccgtgccgggtattgccggttacgcgacggcggctcccatcctcttc
gaggcctttgaaaaatcgggcgtggccatcacgccaatgccgacagcaccctccggcgtc
gcgcgcgtgagcgtggccgaccttccggcaaaccagcggcgttttacgacgaccgcaaac
ggcctgctttcggcttcaagacgtgaaagcgccccgcgcatcgtttatccgcccgagggc
gcgcgggtggagctttccggccagtcgggcatctcgccactggtgctgaagcttcagggc
gggcgtgcacccttccgctggctcgccaacggtttgcctttgccggatgcgtcccaccgt
cgcaacagtgaatggcgaccggaagggcaggggttttccacactcacggtgattgacgcc
gatggccgtgcgtcgagtgtccggattttcgtcgaatga

DBGET integrated database retrieval system