KEGG   Rhizobium pusense IRBG74: BN877_I0293
Entry
BN877_I0293       CDS       T02867                                 

Gene name
bacA1
Definition
(GenBank) Undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I0293 (bacA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I0293 (bacA1)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     BN877_I0293 (bacA1)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Diphosphatase
   BN877_I0293 (bacA1)
SSDB
Motif
Pfam: BacA
Other DBs
NCBI-ProteinID: CDI07208
UniProt: U4PQ12
LinkDB
Position
286439..287245
AA seq 268 aa
MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL
VYFQKLVSIALALPTSAKARRFVLAVALAFLPAAIIGALAHDFIKTVLFETPMLICVVLI
IGGVILLAVDRMPLNPKYTDIMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGSLLMGTD
KRSAAEFSFFLAMPTMLGAFTLDLYKNRDALSFDDGALIAVGFIAAFVSGLFVVRSLLDF
VSRRGFAPFAWWRIAIGSLGLIALLVLD
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggtgaccaatcgatcatcagcgcgcttctgctgggtatcatcgagggtctgacggag
ttcattcccgtttcgtcaacggcgcatgtgctgctggccgggcacttcctcggcttcaaa
tcacccggcaacacctttgcggttctcatccagctcggtgcgatccttgcgatacttctt
gtttatttccaaaagcttgtatcgatagcgctcgctctgccgacaagcgcgaaagcgcgc
cgcttcgtgctggccgtcgctctcgccttcctgccggcggccatcatcggcgccttggcg
catgacttcatcaagaccgtcctgtttgaaacgcccatgctcatctgcgtggtgctgatc
atcggcggggtcattttgcttgccgtcgaccgcatgccgctgaacccgaaatataccgac
atcatggattatccgccgtcgcttgcattcaagatcggcctcttccagtgcctcgcgatg
attcccggcacatcgcgttccggtgccacgatcgtcggctcgttgctgatgggcacggac
aagcgctccgccgccgaattttcgttcttcctggcgatgccgaccatgctcggcgcgttt
acgctcgatctttacaagaaccgcgatgccctgagtttcgatgacggcgctctgatcgcc
gtcggattcatcgccgctttcgtctcgggtctttttgtcgttcgctcgctcctggatttc
gtctcgcgacggggcttcgcgcccttcgcctggtggcgcatcgccatcgggtcgctggga
cttatcgcgcttctggtcctggactga

KEGG   Rhizobium pusense IRBG74: BN877_I0982
Entry
BN877_I0982       CDS       T02867                                 

Gene name
bacA2
Definition
(GenBank) Undecaprenyl-diphosphatase 2
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I0982 (bacA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I0982 (bacA2)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     BN877_I0982 (bacA2)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Diphosphatase
   BN877_I0982 (bacA2)
SSDB
Motif
Pfam: BacA
Other DBs
NCBI-ProteinID: CDI07896
UniProt: U4PVG4
LinkDB
Position
970267..971103
AA seq 278 aa
MSMGWMEAGFLGLLQGLTEFLPISSSAHLRIAGEFLPSGADPGAAFTAITQIGTEMAVLV
YFWSDIMRIAAAWLRQNLRLGPYDKADARLGWLIIVGSVPIVLLGLLFKDAIEHSLRNLY
ITAVMLIVFGIVLGVADRIGKKRYKLNQLIWRDGILFGFAQAMALIPGVSRSGGTISAGL
LLGYTREAAARYSFLLAVPAVFGSGFYQLFKSIGEDNPVGWGPTGLATLIAFIVGYAVIV
VFLKLVSTKSYMPFVWYRVVIGVILLGLLGTGVINAGG
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcatgggttggatggaggccggatttctcggtcttttgcaaggacttacggagttt
ctcccaatttcgtcgagcgcgcatctgaggatcgccggggagttcctgccctccggcgcc
gaccccggcgctgccttcaccgccattacccagatcggcacggaaatggccgtgctggtc
tatttctggtccgacatcatgcggatcgctgccgcctggctccggcaaaaccttcgtctc
ggcccctatgacaaggccgatgcacgtctcggctggctgatcatcgtcggctccgtgccc
atcgtgctgctcggccttctcttcaaggacgccatcgagcattcgctccgaaacctctac
attactgccgtgatgctgatcgtgttcggtatcgttcttggcgtcgccgacaggatcggg
aaaaagcgctacaagctcaaccagctgatctggcgtgatggtatcctcttcggtttcgcg
caggccatggcgcttatccccggcgtttcgcgttccggcggcaccatcagcgccggcctg
cttctgggttatacccgcgaggcggcggcccgttattccttcctgctcgccgtacccgcc
gtcttcggctccggtttctaccagctgttcaaaagcatcggcgaagacaatccggtgggc
tggggcccgacaggcctcgcgaccctgatcgccttcatcgtcggttacgccgttatcgtc
gttttcctgaagctggtttcgaccaaaagctacatgcccttcgtctggtaccgcgtggtc
atcggcgtcattcttttggggctgctgggaacgggcgtgatcaacgcgggtgggtga

DBGET integrated database retrieval system