KEGG   Rhizobium pusense IRBG74: BN877_I0516
Entry
BN877_I0516       CDS       T02867                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase 1) (UDP-N-acetylglucosamine enolpyruvyl transferase 1) (EPT 1)
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00520  Amino sugar and nucleotide sugar metabolism
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN877_I0516 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I0516 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I0516 (murA)
Enzymes [BR:rir01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BN877_I0516 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BN877_I0516 (murA)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: CDI07431
UniProt: U4PTY5
LinkDB
Position
complement(511907..513199)
AA seq 430 aa
MDRIRITGGNKLNGIIPISGAKNAALPLMIASLLTSDTLTLENVPHLADVEQLIRILGNH
GVDISVNGRRESQGEAYSRTVHFTCRTIVDTTAPYELVSKMRASFWVIGPLLAREGRARV
SLPGGCAIGTRPVDLFIEGLQALGATMEIDGGYINASAPKGGLIGAVYTFPKVSVGATHV
MLMAASLARGTTVIHNAAREPEVVDLAHCLIAMGAKIEGAGTSTITIEGVTSLSGARHRV
LPDRIETGTYAMAVAMTGGDVVLEGTRASLLDNALDTLRLAGATISETETGLRVVRNGNG
IQPVDVVTEPFPGFPTDLQAQFMALMTRSQGVSHITETIFENRFMHVQELARLGAKISLS
GQMARIEGVSRLKGAPVMATDLRASVSLVIAGLVAEGETMVSRVYHLDRGFERLEEKLTR
CGALVERVSD
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggatcgcatcagaattacgggtggcaacaagctcaacggcatcatccccatctccggc
gctaaaaacgccgccttgccgctgatgatcgcatcgctgctgaccagcgatacactgacg
ctcgaaaacgttccgcatctggctgacgtggagcagctgatccgtatcctcggcaatcat
ggcgtggatatttccgtgaatggccgccgcgaaagccagggcgaagcttattcccgtacc
gtgcatttcacctgccgcaccattgtcgataccaccgctccgtacgagctggtctccaag
atgcgtgcaagcttctgggtcatcggcccgcttctggcgcgtgagggccgcgcccgcgtc
tccctgcctggcggctgcgccatcggcacgcgtcccgttgacctgttcatcgagggcctg
caggcgctcggcgcgacgatggagatcgatggcggctacatcaatgcctcggcccccaag
ggcggcctcatcggcgcggtctataccttccccaaagtttcggttggcgcgacgcatgtg
atgctgatggctgcaagccttgcccgcggcacaaccgtgatccacaacgccgcccgcgag
cccgaggttgtcgatctggcgcactgcctgatcgcaatgggcgcgaagatcgaaggcgcc
ggcacctccaccatcaccatcgaaggcgtcacctcgctttccggcgcgcgccaccgggtt
ttgcccgatcgtattgaaaccggcacctatgccatggcagtggccatgaccggcggtgat
gtcgtgctggaaggcacgcgcgcatcgctgctcgacaatgcacttgatacgctcaggctc
gcgggcgctacgatcagcgagacggaaaccggcctgcgcgtggtgcgcaacggcaatggc
attcagccggtcgatgtcgtcactgaaccgttccccggcttcccgacagacctgcaggcg
cagttcatggcgctgatgacccgttcccagggcgtttcccacattaccgaaacgatcttc
gaaaaccgcttcatgcatgtgcaggagcttgcccggctcggtgcgaagatttcgctttcc
ggtcagatggcccgcatcgaaggcgtttctcgcctcaagggtgcgcctgtgatggcgacc
gatctgcgcgcttccgtgtcgctggtcattgccggtctcgtggccgagggcgagaccatg
gtgtcgcgcgtctatcatctagaccgcggcttcgaacgcctcgaggaaaagctcacccgc
tgcggcgcgttggtcgagcgcgtcagcgattga

DBGET integrated database retrieval system