KEGG   Rhizobium sp. IRBG74: BN877_I0733Help
Entry
BN877_I0733       CDS       T02867                                 

Gene name
fabI2
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00061  Fatty acid biosynthesis
rir00780  Biotin metabolism
rir01100  Metabolic pathways
rir01130  Biosynthesis of antibiotics
rir01212  Fatty acid metabolism
Module
rir_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN877_I0733 (fabI2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN877_I0733 (fabI2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BN877_I0733 (fabI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rir01004]
    BN877_I0733 (fabI2)
Enzymes [BR:rir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BN877_I0733 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BN877_I0733 (fabI2)
Lipid biosynthesis proteins [BR:rir01004]
 Fatty acid synthase
  Component type
   BN877_I0733 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CDI07647
UniProt: U4PR66
LinkDB All DBs
Position
complement(737614..738432)
Genome map
AA seq 272 aa AA seqDB search
MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAEVALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLETIDAVFASLEKHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTM
DISVFSLAAVAKRAEPVMNDGGSIVTLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDL
GNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVSIEEVGKSALYLLSDLS
TGVTGEIHHVDSGYHTIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcatccggcctcatggctggcaaacgcggcctcatcatgggtgtcgccaat
aatcgttccatcgcttggggcatcgccaaggcctgcgccgacgcgggcgcggaagtggct
ctcacctggcagggcgatgcgctgaagaagcgtgtcgagccgctggcccaggaactcggc
gccttcatggccggtcactgcgatgtgaccgatctcgagacgatcgatgcggtttttgcc
agcctggaaaagcactggggcaagatcgacttcgtcgtgcacgccattgccttttccgac
aaggacgagctgaccggccgttacctcgacaccagccgcgacaatttcaaccgcaccatg
gacatttccgtcttctcgctggccgccgttgccaagcgggcggagcccgtcatgaatgac
ggtggttcgatcgtgacgctcacctattacggcgccgaaaaggtgatgccgaactacaac
gtcatgggcgtggccaaggccgcgcttgaggcaagcgtgcgttacctcgccgtcgacctc
ggcaatcgcggcatccgcgtcaatgccgtttccgccggccctatcaagacgctcgctgcc
tccggcatcggcgacttccgttacattctcaagtggaacgaatataatgcgccgctgaag
cgcaccgtttcgatcgaggaagtcggcaagtcggcgctttacctgctctccgacctttcg
accggcgtgaccggcgaaatccaccatgtcgattccggttaccacaccatcggcatgaag
gcggtggatgcgcctgacatttcggtggtgaaggactga

DBGET integrated database retrieval system