KEGG   Rhizobium pusense IRBG74: BN877_I0921
Entry
BN877_I0921       CDS       T02867                                 

Gene name
bla
Definition
(GenBank) Beta-lactamase OXA-18
  KO
K17838  beta-lactamase class D [EC:3.5.2.6]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I0921 (bla)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BN877_I0921 (bla)
SSDB
Motif
Pfam: Transpeptidase Beta-lactamase2
Other DBs
NCBI-ProteinID: CDI07835
UniProt: U4Q5L6
LinkDB
Position
905736..906560
AA seq 274 aa
MRYRLPAIFLLCLALPGLLPFSADAQQQPQAFECTLVTSIETGAIINQQGACDQRVAPAS
TFKVPLALIGYDAGILQDEKSPAWDWKPGTEARAADRKTVDPTIWEQDSVLWYSREITRR
LGPEKFAAYVKRLGYGNADVSGEPGKNNGLTHSWLGASLTISPVEQVGFLRRLLAGNLPF
SRDAQAKTRAIVPVFDAPESWAVHGKTGTGYMRDEKGNPDRNRPFGWFVGWAEREGQHIV
FARLRVSDKPSNEPLGPAVRDAFLRDIPRLAVHR
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcgctaccggctgcccgccatctttcttttatgccttgcccttccggggctcctgccg
ttttccgctgacgcccagcaacagccccaggccttcgaatgcacgctggtcacatcaatc
gagaccggcgccatcatcaaccagcagggcgcctgcgaccagcgggtggcgccagcctcc
accttcaaggtgccgctggcgctgatcggttacgatgccggtattctccaggatgaaaaa
tcgcccgcctgggactggaaacctggcacggaggcgcgcgccgccgaccgcaagacggtc
gacccgaccatctgggagcaggattcggtgctgtggtattcgcgcgagatcacccgccgc
ctcggcccggaaaaattcgccgcctatgtgaagcgtctcggttacggcaatgccgatgta
tcgggcgagcctggcaagaacaatggactcacccattcctggctgggggcgtcgctcacc
atctcgccggtggagcaggtcggtttccttcgccggttgcttgccggcaatcttcctttc
tcccgcgatgcgcaggccaagacgcgcgccatcgtaccggtcttcgatgcgccggaaagc
tgggccgtgcacggcaagaccggaaccggctacatgcgtgacgaaaagggcaatcccgac
cgcaaccgccccttcggctggttcgtcggctgggcggagcgtgaaggccagcacatcgtc
ttcgcaaggctgcgtgtttccgacaagccgtcaaacgagccgctcggcccagccgtgcgc
gatgccttcctgcgcgatatcccgcggctggcggtgcatcggtag

DBGET integrated database retrieval system