KEGG   Rhizobium pusense IRBG74: BN877_I0962
Entry
BN877_I0962       CDS       T02867                                 

Gene name
degP
Definition
(GenBank) Serine protease do-like precursor
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01503  Cationic antimicrobial peptide (CAMP) resistance
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_I0962 (degP)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I0962 (degP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rir01002]
    BN877_I0962 (degP)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rir03110]
    BN877_I0962 (degP)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     BN877_I0962 (degP)
Peptidases and inhibitors [BR:rir01002]
 Serine peptidases
  Family S1: chymotrypsin family
   BN877_I0962 (degP)
Chaperones and folding catalysts [BR:rir03110]
 Other chaperones and cochaperones
  DegP / HtrA
   BN877_I0962 (degP)
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 PDZ PDZ_6 Trypsin Tricorn_PDZ PDZ_1 DUF3394 Peptidase_S46 DUF6288 DUF5678
Other DBs
NCBI-ProteinID: CDI07876
UniProt: U4PVE4
LinkDB
Position
943492..945045
AA seq 517 aa
MSHSQNGHSSLKTALKATTVGGLAALMLSTGIAAPILHSFAAPVEVTAPQVPSFANVVDA
VSPAVVSVRVQSNVQPASDDSSNFSFNFGGRGLDQLPDDHPLKRFFKEFGGPNQDRSDRG
PNRHRDGKGPLRPVAQGSGFFISEDGYIVTNNHVVDDGSAYTIVMNDGTELDAKLVGRDP
RTDLALLKVDVNRKFTYVQFADDSKIRVGDWVVAVGNPFGLGGTVTSGIISARGRDIGSG
PYDDYLQIDAAVNRGNSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVIAD
LQKDGKVERGWLGVQIQPVSKDIAESLGLSEAKGALVVSPQSGSPGDKAGIKQGDIITAV
NGEPVKDARDLSRRIGGMAPNSKVEISLWRGGKSQSVTVTLGDLASDDASKATPSQNDDK
GGQSSSEKVLSSLGLTVAPADDGNGLAITDVDPDSDAAARGLKTGEKITSVNNQQVASAA
DIEKILEQAKKDGRSKALFQIQTDDGSRFIALDIDQG
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtctcattcgcaaaacggccattcctcgctgaagacagccctgaaggccacgacggtt
ggcggccttgcggcgctgatgctttccaccggcattgccgcacctatcctccactctttt
gccgcccccgtcgaggtgactgcgccgcaggttccgagcttcgccaacgtggtcgatgcg
gtatcacccgccgtcgtgtccgttcgcgttcagtcgaacgtgcagcctgcttccgatgat
tccagcaatttctcctttaatttcggtggccgtggccttgaccagcttccggatgaccat
ccgctcaagcgcttcttcaaggaattcggcggcccgaaccaggatcgttccgaccgcggc
cccaatcgccaccgtgacggcaagggtccgctgcgccccgtcgctcagggctccggcttc
ttcatttccgaagatggttacatcgtcaccaacaaccacgtcgtcgatgacggctccgcc
tatacgatcgtgatgaatgacggcaccgaactcgacgccaagctcgtcggccgcgatccg
cgcaccgatctggcactcctcaaggtcgatgtgaaccgcaagttcacctacgttcagttt
gccgatgacagcaagatccgcgtcggtgactgggtcgtcgccgttggcaatcccttcggc
cttggcggcacggtgacttccggcattatctcggcccgtggccgtgatatcggctccggc
ccctatgacgactacctgcagatcgacgccgccgtgaaccgcggcaactcgggcggtccc
gccttcaacctcaacggtgaagtggttggcatcaacaccgccatcttctcgccctcgggc
ggcaatgtcggcatcgccttcgccattccggcatcggtcgccaaggacgtgatcgccgac
ctgcagaaggacggcaaggtagagcgcggctggctcggcgtgcagatccagcccgtcagc
aaggacatcgccgaatcgctcggcctttccgaagccaagggcgccctggtcgtttcgccg
cagtccggctcgccgggcgacaaggcaggcatcaagcagggtgacatcatcaccgccgtc
aacggcgaacccgtcaaggatgcccgcgacctgtcacgccgcatcggcggcatggcgccg
aacagcaaggtggaaatctcgctgtggcgcggtggcaagtctcagtcggtcacggtgacg
ctcggtgatctcgccagcgacgatgcctccaaggcgaccccgagccagaacgacgataag
ggcggtcagtcttccagcgagaaggtgctgtccagcctcggcctgacggtggcccccgcc
gatgacggcaacgggcttgccatcaccgatgtcgaccctgacagcgatgccgctgcccgt
ggcctgaagacgggtgagaagatcacctcggtcaacaaccagcaggtcgcatccgccgcc
gatatcgagaagatcctcgagcaggcgaaaaaggacggacgctccaaggcgctgttccag
atccagacggatgacggcagccgcttcatcgctctggatatcgaccagggttga

KEGG   Rhizobium pusense IRBG74: BN877_I2119
Entry
BN877_I2119       CDS       T02867                                 

Definition
(GenBank) Putative Serine protease do-like precursor
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01503  Cationic antimicrobial peptide (CAMP) resistance
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_I2119
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I2119
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rir01002]
    BN877_I2119
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rir03110]
    BN877_I2119
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     BN877_I2119
Peptidases and inhibitors [BR:rir01002]
 Serine peptidases
  Family S1: chymotrypsin family
   BN877_I2119
Chaperones and folding catalysts [BR:rir03110]
 Other chaperones and cochaperones
  DegP / HtrA
   BN877_I2119
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 PDZ PDZ_6 Trypsin Peptidase_S46 Peptidase_S29 Peptidase_S7 DUF6288
Other DBs
NCBI-ProteinID: CDI09010
UniProt: U4Q5K7
LinkDB
Position
complement(2008577..2010121)
AA seq 514 aa
MAVTLLSPFRSSISAVAVIALVAGSFAAPLPAGAQSHGPESVADLAEPLLDAVVNISTSQ
NVKTDGKGPVPPRLPEGSPFQEFFKDYFDSQKPEGGEKVNSLGSGFVIDPAGYVVTNNHV
IEGADAIEVIFPNGSKLKATLVGTDTKTDLSVLKVEPKTPLKAVKFGDSRSMRIGDWVMA
VGNPFGLGGSLTVGVISARGRNINAGPYDNFIQTDAAINKGNSGGPLFNMKGEVIGINTA
IISPSGGSIGIGFAVPTELAQNIVQQLIEFGETRRGWLGVRVQPVTDDVAASLGMDSAKG
ALISGVAKGGPVENGPIQAGDVVLKFDGKDIHEMRDLLRIVAESPVGKEVDVVILRDGKE
ETVKVKLGQLQDTTDEKASTDDQQTDDGDSGVIAPEDNDGGDDQAQDQTPEVREAPQSVL
GMNLVVLSNELRTEKGIAESVEGVLVASVDPGSSAEQKGMKAGDVIVEVGQDFMEVPGDV
LVRVNGLKSEGRKNAHMMVADAQGNLRVVALPLE
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccgtgacccttctttcgccttttcgcagcagcatttccgcagtcgcggtaatagcg
cttgttgcgggcagctttgcggcgccgcttccggcgggcgcgcaaagccacgggccggaa
tctgttgccgatcttgccgagccgctgctggatgcggtggtgaatatttccacgtcgcag
aacgtcaagacagatggcaaggggccggttccgccacgtctgccggaaggttcgcccttc
caggagttcttcaaggattatttcgacagccagaagccggaaggcggtgaaaaggtcaat
tccctcgggtccggttttgtgatcgatcccgccggttatgtcgtcaccaacaaccacgtc
atcgagggtgccgatgccatcgaggtgattttcccgaatggctcgaagctcaaggcgacg
cttgtcggcaccgataccaagaccgatctttccgttctgaaggtggagccaaaaacgccg
ctgaaggcggtcaaatttggcgattcgcgcagcatgcgcattggcgactgggtaatggcg
gtcggtaaccccttcgggcttggcggatcgctgaccgttggcgtcatttcagcgcgcggc
cgcaatatcaatgccggcccttatgacaatttcatccagacggatgcggccatcaacaag
ggtaactccggtggcccgctcttcaacatgaagggcgaggtgattggcatcaatacggcg
atcatttcgccgagcggtggttcgatcggtatcggtttcgccgtgccgacggagcttgca
cagaacatcgttcagcaactgatcgaattcggagagacccgccgcggctggctgggtgtt
cgtgtccagccggtcacggacgatgtggccgcgagcctcggcatggacagcgccaagggc
gcgctgatttccggggtcgccaagggcggcccggtggaaaacggtccgatccaggctggc
gacgtcgtgctgaaattcgatggcaaggatattcacgagatgcgcgaccttctgcggatc
gtggcggaaagcccggtcggcaaggaagtcgatgtcgtcatcctgcgcgacggaaaggaa
gagaccgtcaaggtcaagctgggccagctgcaggataccacggatgagaaggcttcgact
gacgaccagcagactgacgacggcgacagcggtgtgatcgcgccggaagacaatgatggc
ggcgacgatcaagcccaggatcagactccggaggtgcgtgaagcgccgcagagcgtgctt
ggcatgaatctcgttgttctcagcaatgagttgcggacggaaaagggcattgccgagagc
gttgaaggcgtgctggtcgcaagtgtcgatccgggttcgtccgcagaacagaagggcatg
aaggcaggcgatgtgattgtggaagtcggacaggacttcatggaggttcccggcgacgtg
ctggtgcgggtgaatggtctgaaatcggaaggccgcaagaacgcccacatgatggtggcc
gatgcgcagggcaatctgcgcgtggtggcgctgccgctggaataa

DBGET integrated database retrieval system