KEGG   Rhizobium pusense IRBG74: BN877_I1054
Entry
BN877_I1054       CDS       T02867                                 

Definition
(GenBank) Cell division protein FtsI/penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I1054
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I1054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I1054
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I1054
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I1054
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BN877_I1054
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I1054
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Other DBs
NCBI-ProteinID: CDI07966
UniProt: U4PVM9
LinkDB
Position
1035257..1037017
AA seq 586 aa
MIAFVMRLKSRTHFIIKRNPLRGREVVFGSVARRRAEAKTRLAIVIAVFIAIYGVAAARL
VQYGLAEPVSTAWINSGVNAIASRPDIVDRNGTLLATDLNMVSLYADPRRIVDPDEVVEK
LATVIPNLDWRETHRRLRSDTGFQWLRRQLTPRQQADILNLGIPGIGFRPEKRRFYPGGP
TASHIIGHVNVDNQGLAGMERYLDQQGLADLRAVGLASGTPLEPVRLSIDLRVQNIVRDV
VVKAKSAYQAEAAGSVILDVETGEVLAMASVPDYDPNEPSRTLADGSVDKEYEKGWFNRM
SNATFEMGSTFKSFTLAMGLDAGAITLNSVVDASRPIRMGGFTIRDFKGRNRPLSIPEVF
QFSSNIGTAAVADRVGVEGHQQFLTKLGLLTRMDTEMPGVATPTQPRNWKKINSVTISFG
HGVATTPLQTAVAAAALINGGSLISPTFLPRSKEAAASLARSVINDRTSADMRYLFNWNG
IKGSGRGAQVEGFHVGGKTGTADKVINGRYAKDINFNAFVAGFPMHKPKYVVLTMIDAPR
TGVNGGRTAASTAAPMTREIIAQTAGLLGVKPRFGYEGNPQLLVDY
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgattgctttcgtgatgcggctgaagagccggacgcatttcattatcaagagaaaccca
ctgcggggcagggaggtcgtgttcggttcggtcgcccgccgccgggcggaggcaaagacg
cggcttgcgatcgtcatcgccgtcttcattgcgatatatggcgttgccgcggcgcgcctc
gttcaatatgggctcgccgaacccgtttccaccgcatggatcaattccggcgtcaacgcc
atcgcctcacggcctgacatcgtcgaccgcaacggcacgcttctggcgaccgatctcaac
atggtatcgctttatgcggatccgcgcaggatcgtcgatccggacgaggtggtggaaaaa
ctcgcgaccgtcattcccaatctggattggcgcgagacgcatcgtagattgcgttcggat
acaggcttccagtggttgcgacgccagctgacaccgcggcagcaggcggatattctcaat
ctcggcataccgggtatcggtttccgcccggaaaaacggcggttttatccgggcggccca
accgcttcgcatattatcggccacgtcaatgtcgacaatcagggtctcgccggcatggag
cgttacctggaccagcaggggctggccgatctgcgcgctgtgggtcttgccagcggcacg
ccactggaaccggtgcggctgtccatcgatctcagggtacaaaacatcgttcgcgacgtg
gtcgtgaaggcgaaaagtgcctatcaggccgaagccgccggttcggtgatcctcgatgtg
gagacgggcgaagtgctggccatggcttccgtcccggattacgatccgaacgaaccttcc
cgcaccctcgctgatggcagcgtcgacaaggagtatgaaaaaggctggttcaacaggatg
agcaacgccaccttcgagatgggctccacattcaagagcttcacgctcgccatgggtctg
gatgccggggcgattacgctcaattcggtggtggatgcgtcgcggccgatccgcatgggc
ggcttcaccatcagggatttcaagggaagaaaccggccgctctccattccggaagtgttt
caattttcatcgaatatcggcacggcggcggtggctgacagggtcggtgtcgagggccat
caacaattccttacgaagcttggtctgctgaccagaatggacacggaaatgcccggcgtt
gccacgccgacccagccgagaaactggaagaagatcaattccgtcaccatctccttcggc
catggcgttgctaccactccgttgcagacggcggtggccgctgcagcccttatcaatggc
ggaagcctgatctcaccgaccttcctgccgcgttcgaaagaggctgcggcatcgctcgcg
cgcagcgtcatcaacgacaggacgagcgccgacatgcgttacctcttcaactggaacggc
atcaagggttccggccgtggcgcacaggtggaggggtttcatgtcggcggcaagacgggg
acggcagacaaggtgatcaatggccgttacgccaaggacatcaatttcaacgccttcgtg
gccggttttcccatgcacaagccgaaatatgtcgtgctgaccatgatcgatgcgccaagg
accggcgtgaacggcggccgcacggcagcctcgacagcggcccccatgacgcgcgagatc
atcgcccagacggcgggccttctcggtgtcaaaccgcgcttcggctacgagggaaacccg
caattgctggtggattactga

KEGG   Rhizobium pusense IRBG74: BN877_I2175
Entry
BN877_I2175       CDS       T02867                                 

Gene name
ftsI
Definition
(GenBank) division-specific transpeptidase, penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2175 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I2175 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2175 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2175 (ftsI)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I2175 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BN877_I2175 (ftsI)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2175 (ftsI)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase
Other DBs
NCBI-ProteinID: CDI09066
UniProt: U4Q944
LinkDB
Position
complement(2069680..2071422)
AA seq 580 aa
MSFLSRAMVLKSKAHFSASTTGIHTDHAAFEGARKKRAAQAKSRVGLLIFGFVAFYAVVG
GRLVQYGMAEQETVSSIAPADRLMASRPDLLDRNGEVLATDIRTVSLFAEPHRIVDIDEA
IEKLRTVLPDLDQRTTYQKLSSNSRFQWLRRQLTPKQQSQILALGIPGIGFRPEKRRFYP
GGPTAAHVVGHVNIDNRGVAGMERYVDSQGLADLTALGMTSDQPLEPVKLSIDLRVQSIV
REVVTSAITKFQAIGAGAVVLDVHTGEVLAMASVPDYDPNNPAEGAKEGWLNRMSNGTFE
MGSTFKSFTIAMGLDSGRVRLGDMFDARYPIRIGGFTIKDFHGKGRMLSVPEIFQFSSNI
GTAKIADTVGTEGHKEFLTRLGLLTRMQTELPEVALPSQPREWKKINSITISFGHGVSTT
PLQTAVAGAALVNGGKLIEPTFLPRTREQADQVAKQVLKPGASKDMRFLFEWNGVNGSGR
NARVDGFNVGGKTGTADKVVNGRYVHDKNFNAFLSAFPMDDPQYVVLSFIDEPKTDKGNG
AALAGTSAAPMVHDIISRTAAVLGVKPKFGKDGSALLVSY
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtcttttctctcccgcgccatggttttgaagagcaaggctcacttttccgccagcacg
accggcatccacaccgatcatgcggcgtttgaaggcgcgcgcaagaagcgcgcggcgcag
gcgaaaagccgcgtcggccttctcattttcggtttcgtcgccttttacgccgtcgtcggc
ggccgtctggtgcaatatggcatggcagagcaggagacggtgtcgagcatcgcgccggcc
gacaggctgatggcgtcgcgccctgatcttctcgaccgtaacggcgaggtgctggccacc
gatatccgcaccgtctcgctgtttgccgagccccatcgtatcgtcgatattgacgaggcc
atcgaaaagctgcgcaccgtcctgccggatctcgaccagcgcacgacctatcagaagctc
tcctccaattcgcggttccagtggctgcgccgccagttgacgccaaagcagcagagccag
attctcgcgctcggcattcccggcatcggcttccgtccggaaaaacgccgcttctatccc
ggcgggccgaccgcagcgcatgtcgtcggtcacgttaatatcgacaaccgcggtgttgcc
ggcatggagcgttacgtcgacagccagggtcttgccgatctcacggcgctcggcatgacg
agcgatcagccgctcgagcctgtgaagctttccatcgacctgcgcgtgcagtccatcgtg
cgcgaagtcgtgacttcggccatcaccaagttccaggcgatcggcgccggtgccgtggtt
ctggatgtgcataccggcgaagtgctggccatggcctcggtgccggattacgatccgaac
aacccggccgaaggcgcgaaggaaggctggctcaaccgcatgtcgaacggcacgttcgaa
atgggctccaccttcaaatccttcaccattgccatgggtcttgattccggccgtgtccgc
ctcggtgatatgttcgacgcgcgttacccgatccgcatcggcggcttcaccatcaaagac
ttccacggcaagggccgcatgctctcggtgccggaaatcttccagttttcgtccaatatc
ggtacggccaagattgccgataccgttggcaccgaagggcacaaggaattcctgacgcgg
cttggtcttctcacccgcatgcagaccgaactgcctgaagtggcgctgccttcgcagccg
cgtgagtggaagaagatcaactccatcaccatctccttcggccacggcgtttcaaccaca
ccgctgcagacggcggttgccggtgcggcactcgtcaatggcggcaaactcatcgagccg
accttcctgccgcgcacccgtgaacaggcggatcaggtggcaaagcaggtgctgaaaccc
ggcgccagcaaggatatgcgcttcctcttcgaatggaacggcgtcaacggttcaggccgg
aatgcgcgcgtcgatgggttcaacgtcggcggcaagactggcacggccgataaggtcgtc
aacggccgttatgtgcacgacaagaacttcaacgccttcctgtcggctttcccgatggat
gatccgcaatatgtggtgctgtccttcatcgacgaaccgaagaccgacaagggcaatggc
gcggcactcgccggcacgtccgcagcgcccatggtgcacgatatcatcagccgcacggcg
gcggtgctgggtgtgaagccgaagttcggcaaggatggctcggccttgctcgtgtcttat
tga

DBGET integrated database retrieval system