KEGG   Rhizobium pusense IRBG74: BN877_I1321
Entry
BN877_I1321       CDS       T02867                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I1321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I1321
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I1321
Enzymes [BR:rir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BN877_I1321
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BN877_I1321
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I1321
SSDB
Motif
Pfam: Amidase_3 AMIN TSGA13 VDE
Other DBs
NCBI-ProteinID: CDI08229
UniProt: U4PSW4
LinkDB
Position
1288501..1289769
AA seq 422 aa
MKTMNFTRSATKSGGAGWIGARIARLAAVVTLSAVASVSVVPAVQATEPLVAHQARIIGD
EARTRIVLDFAEEPEFDVHYLDSPARIVVDFPAVNFSFPASDLRPTGLFSDIRFGGMGEN
SARIVLTAKKPVRVAVAETKKADDGQSFRFVLDTEITTKGKFAELVKEQQWQAPAPVTTA
AISPADKTSRPAEFVIAVDAGHGGIDAGASGGTTGTEEKVITLMFAKELAERLNREPGIK
AFLTRDSDTFLALSERVTIARQNNANLFISLHADTLKQKGIRGATVYTLSDRASDRMAQE
LAERENKSDQIAGVAVSSEPPEVADILLDFTRRETQAFSVTLAENIVSSFEGQVGLINNP
HRYAGFMVLRAHDVPSVLLELGFLSNPDDEKLLLDAEWRKKVADTLATAVGRYRSKALAN
GG
NT seq 1269 nt   +upstreamnt  +downstreamnt
ttgaagaccatgaatttcacgcgcagcgcaacgaaatcaggtggggcagggtggattggc
gcgcgaatcgcgcggcttgcggctgtcgtgacattgtctgccgtcgcctcggtttccgtc
gttccggccgtccaggcaacagagccgcttgtcgcgcatcaggcccgcatcatcggtgat
gaggcgcgcacgcgcatcgttctcgattttgccgaggagccggagttcgacgttcactat
ctcgattcgcccgcccgcatcgtcgtggacttcccggcggtgaatttcagctttcccgca
tccgatctcaggccgaccggccttttttccgatattcgcttcggcggaatgggggaaaac
agcgcccgtatcgtgctgacggcgaagaagccggtgcgggtggcggtcgctgaaacgaaa
aaggccgatgacgggcaatccttccgtttcgtcctcgatacggagatcaccaccaaaggc
aagttcgccgaacttgtgaaggagcagcagtggcaggcgccagcgcccgttaccaccgcc
gcgatttctcccgcggacaagacttcccgcccggcggaattcgtcatcgcggtcgacgcc
ggtcatggaggcatcgacgcaggcgcctcaggcggcacgacgggcaccgaggaaaaggtc
atcaccttgatgttcgcgaaggagctcgcggagcgcctgaaccgcgagcccggcataaag
gccttcctgacgcgcgattccgatacatttcttgccttgtccgaacgcgtgacgatcgcg
cggcagaacaacgccaatcttttcatctccctgcatgccgatacactgaaacagaagggc
atacgcggcgcgaccgtctatactttgtccgatcgcgcgtcggaccgtatggcgcaggaa
ttggcggagcgtgaaaacaagtccgaccagatcgccggtgtcgccgtttccagcgagccg
ccggaagtcgccgatattctcctcgatttcacgcgccgggaaacccaggcgttctcggtg
acactcgccgaaaacatcgtttcttccttcgaggggcaggttggcctcatcaacaatcca
catcgttacgccggtttcatggtgttgcgcgcccatgacgtgccatcggtgcttctcgag
cttggtttcctttccaatcctgacgacgagaagctgcttctcgatgcggaatggcgcaag
aaggtggccgatacgctggcaacagccgtcgggcggtaccgttcgaaggctctggcgaac
ggtggctga

DBGET integrated database retrieval system