KEGG   Rhizobium pusense IRBG74: BN877_I1364
Entry
BN877_I1364       CDS       T02867                                 

Gene name
ispU
Definition
(GenBank) Undecaprenyl pyrophosphate synthetase 2 (UPP synthetase 2) (Di-trans,poly-cis-decaprenylcistransferase 2) (Undecaprenyl diphosphate synthase 2) (UDS 2)
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir00900  Terpenoid backbone biosynthesis
rir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I1364 (ispU)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN877_I1364 (ispU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rir01006]
    BN877_I1364 (ispU)
Enzymes [BR:rir01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     BN877_I1364 (ispU)
Prenyltransferases [BR:rir01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BN877_I1364 (ispU)
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: CDI08271
UniProt: U4Q6Q5
LinkDB
Position
1331673..1332416
AA seq 247 aa
MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGIRYLTLF
AFSSENWRRPESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKNDIRSLLEEAE
QMTADNTKLTLVIAFNYGSRDEIARATASIALDVAAGRLDAASITPEMISARLDTSGIPD
PDLIIRTSGEERLSNFLLWQAAYSEFLFIPEYWPDFDRQLFFSAIEQYATRDRRFGALTE
QVAVAGA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgccgacgacgacacgttcctccatacccgagcacgtcgccatcatcatggatggcaac
ggccgctgggcaaagcagcgcggcctcccgcgcgtgatggggcatcgccgcggtgtggag
gccgtgcgcgagaccgtgcgcgcggccggtgactgcggcatacgctatctcaccctcttc
gccttctcgtcggaaaactggcgcaggcccgaatccgaggtaagcgacctgatggggctt
ttgaaggctttcatccgccgcgaccttgccgaactgcaccgcgagaacgtccgcgtgcgg
atcatcggtgaccggcaggggctgaagaacgatattcgctcgcttctggaagaggctgag
cagatgacggccgacaacaccaagctgacgctagtgatcgccttcaactacggcagccgt
gacgagatcgctcgcgcgacggcgtcaatcgcccttgatgttgccgcaggcaggctagac
gctgcttccatcacccccgagatgatttcggcgcggctcgacacctcgggcattcctgat
cctgacctgatcatccgcaccagcggcgaggaacgcctgtctaacttcctgctgtggcag
gcggcctattccgagttcctgttcattccggaatattggccggacttcgaccggcaactc
ttcttctccgcaatcgagcaatatgcaacgcgtgaccgccgcttcggtgcactcaccgag
caggttgccgtggcaggcgcctga

DBGET integrated database retrieval system