KEGG   Rhizobium pusense IRBG74: BN877_I1370
Entry
BN877_I1370       CDS       T02867                                 

Gene name
lpxA
Definition
(GenBank) Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (UDP-N-acetylglucosamine acyltransferase)
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00540  Lipopolysaccharide biosynthesis
rir01100  Metabolic pathways
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BN877_I1370 (lpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I1370 (lpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rir01005]
    BN877_I1370 (lpxA)
Enzymes [BR:rir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     BN877_I1370 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:rir01005]
 Lipid A
  BN877_I1370 (lpxA)
SSDB
Motif
Pfam: Hexapep Acetyltransf_11 Hexapep_2
Other DBs
NCBI-ProteinID: CDI08277
UniProt: U4PWI1
LinkDB
Position
1338518..1339333
AA seq 271 aa
MSTIAASARIHPTAVIEDGAVIGENVVIGALSYVGAKVTLHDDVRLHNHAVVSGLTVIGR
GSVVHPMAVIGGTPQAVRHDGSETTLEIGERCIMREGVTMNAGSSDGSGKTIVGNDNLFL
ANSHVAHDCRLGDHIILSNNVMLAGHVTIEDRAILGGGCAVHQFTRIGRQAFIGGLSAVN
YDVIPYGMLNGNPGILGGLNVVGMTRAGIERADIHKVRRVFKQIFEAEGTIRGNAAAIDR
SEYLDCPQALEIIDFIGVDSDRAISSPNRGK
NT seq 816 nt   +upstreamnt  +downstreamnt
atgagcacgattgccgcctcggccagaattcaccccaccgccgtgatcgaagatggcgcg
gtgatcggtgaaaacgtcgtcatcggtgcgctgagctacgtcggcgcgaaagtcacgctg
catgatgatgtccggctgcacaatcatgccgttgtatccggcctgacggtcatcggccgt
ggatcggtcgtccaccccatggcggtcatcggcggcacgccgcaggcggttcgccacgac
ggttctgaaaccacgctcgaaattggcgagcgctgcatcatgcgcgaaggcgtcaccatg
aacgccggcagctctgatggcagcggcaagacgatcgtcggtaacgacaatctgttcctt
gccaactcacatgtggcgcatgattgccgccttggcgaccacatcatcctgtccaacaat
gtgatgctggccggccatgtgacgatcgaggaccgcgccattctgggcggcggctgtgct
gttcaccagttcacccgcattggccgtcaggccttcatcggcgggctgtccgcggtcaat
tacgatgtcattccctatggcatgctgaatggcaatcccggcattctcggcggccttaat
gtcgttggcatgacgcgtgccggcattgagcgcgcagatatccacaaggtccggcgcgtc
ttcaagcagatcttcgaggcggaaggcactatccgcggcaatgcggcagcgatcgaccgc
agcgaatatctggattgcccgcaggcgctagaaatcatcgatttcattggagtggacagc
gaccgcgcgatctcttcgcccaaccggggcaagtga

DBGET integrated database retrieval system