KEGG   Rhizobium pusense IRBG74: BN877_I1419
Entry
BN877_I1419       CDS       T02867                                 

Definition
(GenBank) Beta-galactosidase/beta-glucuronidase
  KO
K01192  beta-mannosidase [EC:3.2.1.25]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN877_I1419
Enzymes [BR:rir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.25  beta-mannosidase
     BN877_I1419
SSDB
Motif
Pfam: Ig_mannosidase Glyco_hydro_2
Other DBs
NCBI-ProteinID: CDI08326
UniProt: U4Q6W0
LinkDB
Position
complement(1386706..1389156)
AA seq 816 aa
MISSSTPETVIDLAGLWRLTSVDRDHTTELTVPGDIHTALKDAGIIPDPYHGANEKAVQW
VAQQDWVLERTFILDEADASWYLDIDYLDTVAIVFVNDVPVLSADNCFRRYRPDISRAVR
PGENTIRIHFHSNITAGAERQARQPFYIPYHPGNSPIANGNMLRKPQCHFGWDWNIAIAP
LGLYGKILLKRLDTARIEHVVTSQRHIDGGVELHVAVTLFAEGPASLPVYLSLNDERLRL
DCGVGAGETVVRHVFFVENPELWWPAGSGGQTLYTLMVELPDETVTRQIGFRTIELLTDK
DEAGSRFAFRINGREIFCRGANWIPADALYSLTSREKTEDLLCSAVEANMNMIRVWGGGF
YEEDWFYDLCDRLGLLVWQDFMFACNLYPCSEDFLDNVEHEVDYQVKRLSSHPSIALWCG
DNELVGALTWFDESRNNRDRYLVAYDRLNRTIEKALKKAAPEALWWPSSPASGYLDYGDA
WHADGSGDMHYWSVWHENKSFDNYRSVKPRFCSEFGFQSYTSMPVIRTYAEDKDMNIASP
VIELHQKNAGGNERIAGTMFRYFRFPKDFENFVYLSQVQQALAIRTAVDYWRSLKPHCMG
TLYWQLNDTWPVASWSSLDYGGGWKALHYAARRFFQPVTVSAIPAEDGRRINFSMVNDTA
EDVEIDMNIVALTMDGNRVPLKSANGTCTTDKAATLTDIDMSSLPDGTILAWSFIASNGM
TGEGHHVRDTYKALELLPAGLTLTTSSLKNGQFEIDVTASGLALFVMLEADQPGRYSDNH
FDLAAGETRRIIFTPKAGGGQPHFRVFDLHGCQSPH
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgatttcttcctccacgcccgaaaccgtcatcgatctggcagggctctggcgcctgaca
tctgtggacagagatcatacgaccgagcttaccgtccctggggatatccatacggcactc
aaagatgcgggcatcattccagatccctaccacggagccaatgaaaaggctgtgcaatgg
gtggcccaacaggactgggttcttgagcgaacgttcatcctcgatgaggcggacgcaagc
tggtatctcgacatcgactatctcgacaccgtcgcgattgtcttcgtgaacgacgttccg
gtgctcagcgcggacaattgcttccgtcgctaccgccctgacatttcccgtgcagtgcgc
cccggtgaaaacaccattcgcatccattttcactccaatataaccgccggggcggagcgg
caggcgcgccagccgttttatataccctatcacccggggaattcgcctatcgccaatggc
aatatgctgcgcaagccgcaatgccatttcggctgggactggaacatcgcgatcgcgcca
ctcgggctttacggcaaaatcctgctgaaacggctcgatacggcccggatcgagcatgtc
gttacttcacagcgccatatcgacgggggcgtcgagctgcatgtggccgtcaccctcttt
gccgagggaccggcaagcctgccggtttatctgtctctcaacgatgaaaggctgaggctc
gattgcggcgtcggcgcaggcgaaaccgtggtgcgtcacgtcttcttcgtggaaaatccg
gagctctggtggcctgccggcagtggcgggcagacgctctacacgctgatggtggagctg
cccgatgagactgtgacccggcagatcggcttcaggaccatcgagcttctgaccgataag
gatgaggctggcagccgcttcgcgttccgcatcaatggccgggaaatcttctgtcgcggt
gccaactggattcccgcagatgcgctctattcgctcaccagccgggaaaagaccgaagac
ctcctctgctccgcggtcgaggctaacatgaacatgatccgggtctggggcggcggattt
tacgaggaagactggttctacgatctctgcgaccgtcttggcctgctggtgtggcaggac
ttcatgttcgcatgcaatctttatccctgcagcgaggattttctcgataatgtcgaacat
gaggttgattatcaggtgaaacgcctctcctcgcatccttccatcgcgctctggtgcggc
gataacgagctggtgggtgcactgacctggttcgatgagtcccgcaacaatcgcgaccga
taccttgtggcttatgaccgactgaaccgcaccattgaaaaggccctgaaaaaggccgct
cccgaagcgctgtggtggccatcaagccccgcctccggttatctcgattatggcgatgcc
tggcacgcggatggttccggcgacatgcattactggtccgtgtggcacgagaacaagtca
ttcgacaattaccgttcggtgaagccgcgtttctgctcggaattcggtttccagtcctac
acctccatgcctgtcatccgcacctatgcagaagacaaggacatgaacatcgcctccccc
gtcatcgaactgcaccagaaaaatgccggcggcaacgagcggatcgccggtacgatgttc
cgctacttccgcttcccaaaggacttcgagaatttcgtttatctgagccaggtccagcag
gcattggctatccgcacggccgtcgattactggcgctcgctgaagccgcattgcatggga
acgctatactggcagctgaacgacacctggccggtcgcctcgtggtcaagcctcgattat
ggcggcggctggaaggcgctgcattatgccgctcgccgcttcttccagcctgtcacggtt
tcggctattcccgcggaagatggacgccgaataaacttctccatggtgaacgacacggcg
gaagacgtcgagatcgacatgaatatcgttgccctgaccatggacggcaaccgagtgccg
ttgaaatccgccaacggcacctgcacgactgacaaggccgctacgctgaccgacatcgac
atgagcagcctgcctgacggcaccatccttgcctggagcttcatcgcctccaacggcatg
accggcgaaggccaccatgtgcgcgacacctataaagcgctggaacttctgcccgccggt
ctgacactcaccaccagctcactgaaaaacgggcagttcgaaatagatgtcaccgcaagc
gggcttgcgctcttcgtcatgctggaggcagatcagcccgggcgttattccgacaaccat
ttcgatctcgctgccggcgaaacgcggcgtatcatcttcaccccgaaagcgggcggcgga
cagccgcacttccgtgtcttcgatcttcatggctgccagtccccgcattga

KEGG   Rhizobium pusense IRBG74: BN877_I2660
Entry
BN877_I2660       CDS       T02867                                 

Definition
(GenBank) Beta-galactosidase/beta-glucuronidase
  KO
K01192  beta-mannosidase [EC:3.2.1.25]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN877_I2660
Enzymes [BR:rir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.25  beta-mannosidase
     BN877_I2660
SSDB
Motif
Pfam: Ig_mannosidase Mannosidase_ig
Other DBs
NCBI-ProteinID: CDI09545
UniProt: U4Q709
LinkDB
Position
2551129..2553585
AA seq 818 aa
MRTYLPGESEELLSEGWTLALTPADAYETPSDIPASLESLHVSVPGTVAQALEAAEKFDR
LAPTPLNDRDAWYRLTMISDVRERATLRFDGLSTIAEIFFNGVLIAASQSMFERLEVPVE
LTGADELAICFRALAPRLEKTGPRARWRPQMMNTQGLRLIRTTALGYMPGWCPEIHAAGP
WRPISLIRQNGILCTLQSSLDGAGTGTVSIALQGSRPIKSAKLGCAGYSADLSLDEGGTL
SGELRITDVEQWWPHTHGRPTLHDVVLELDGTQYRLARTGFRQVEIDHGEDGKGFGLRVN
GQPVFCRGAVWTTADIVRLPGTRPDYEPWLRKAAEAGMNMIRIGGTMTYETPEFFALCDE
LGIMVWQDAMLANFDYPARDESLRQHIVTEISQFLEATALSPSLAIFCGGSEMYQQGAML
GLPEQIWKGTLTEEVLPELLADKRPDAAYVANSPSGGALPFFPNTGVGHYYGVGAYCRPL
EDARRADLRFAAECLAFANVPEQETLDRYLPGVAVHDPRWKAHAPRDRGASWDFEDVRDH
YLKLLYDVEPDVLRREDGGLYLDMSRAATAEVMEATFAEWRRSGSPCQGALVWTLQDLLP
GAGWGIIDATGRPKSVWHALKRAFRPIQVNLLDEGTNGLDIQLINETGNTFEGMLELTCL
RDGAQPVVHAKRSITLSSRQSQTIAATDLFGAFFDTTYTYRFGPPSHDVTVARLRDVATG
QVIADAFHFPLGRKKALHAANLQVAISQNNDIWSLEIGTDRLAQSVHVAAEGYRASENWF
HLAPGESRKISLVPETAGSQTPPSGDVVSLGSRRRFSF
NT seq 2457 nt   +upstreamnt  +downstreamnt
gtgaggacctatcttccgggtgaaagcgaggaattgctgagcgaaggctggacgctggcg
ctgacgcccgccgatgcctatgaaacgccctccgatattcccgcctcgctcgaaagcctc
catgtctccgttcccggaaccgtggcgcaggctttggaagccgctgaaaagttcgaccgc
ctcgctccgacgcccctcaatgacagggacgcctggtacaggctgacgatgatttccgat
gtccgggagcgtgccaccctgcgcttcgacggtctttccaccatcgcggaaatcttcttc
aacggtgtgctgatcgcggcgagccaaagcatgtttgaaagactggaagtgcctgtggaa
ctgacgggtgcggatgaactcgcgatctgcttcagagcgctggcaccccgacttgaaaaa
accggtccccgcgctcgctggcggccgcaaatgatgaatacgcaggggctgcggctgatc
cgcaccactgcactgggttatatgcctggatggtgcccggaaatacacgccgccggccca
tggcgacccatcagcctgatacggcagaacggaattctctgcacgctgcaatcttcgctg
gacggggccggaacgggaacggtcagcattgcgctgcaaggtagccgcccgataaagtcg
gcaaagcttggctgcgccggttacagcgccgatctttctctcgacgaaggcggcacactt
tccggcgaactgcgcataactgatgtggaacaatggtggccacacacgcatggcaggcca
actctgcatgacgtcgttcttgagctggacggcacacaatatcgccttgcacgcacgggc
ttccggcaggtcgagatcgatcacggcgaagacggtaaaggtttcggcctcagggtgaac
ggtcaaccggtgttctgccgtggcgcggtctggacgacggccgacatcgtgcgcctgccg
ggaacgaggccggactacgagccatggcttcgaaaagcagcggaagcaggcatgaacatg
atccgcatcggcggcaccatgacctatgaaaccccggaattcttcgcactttgcgacgaa
ctcggcatcatggtctggcaggacgccatgctcgccaatttcgattatccggcaagggac
gagagtctgcgccaacacatcgtcacggaaatctcgcagttccttgaagccaccgcgctt
tctccatcgctcgccattttttgcggtggcagtgaaatgtaccagcagggcgcgatgctc
ggccttccggaacagatatggaagggaacgctgaccgaagaggttctgccggaacttctt
gccgacaagcggccggacgcggcctatgtcgccaattccccctccggcggcgcattgccc
ttttttccgaacaccggggtcggccattattacggcgtcggcgcctattgccgtccgctg
gaagatgcgcgtcgcgccgatctgcgctttgccgccgagtgcctggcattcgccaatgtt
cccgaacaggaaacgctggacaggtatctacccggcgtggccgtgcacgatccacggtgg
aaagcgcatgcaccgcgtgatcgcggcgcctcctgggatttcgaggatgttcgcgatcac
tatctcaagctgctttatgatgtcgaaccggacgttctgcggcgagaagacggcggtctt
tatctcgacatgtcccgggccgcgacggccgaagtcatggaggcgactttcgccgaatgg
cggcgcagcggttcaccctgccagggcgctcttgtctggaccctgcaggacctccttccc
ggtgcaggctggggtatcatcgatgccaccggcaggccgaaatccgtctggcatgcgctg
aaaagggcgtttcgccccatccaggtcaatctgctcgacgagggcacgaacgggttggac
attcagctgatcaacgagaccggcaacaccttcgagggcatgctcgaactcacctgcctg
cgcgacggcgcccagcccgtcgttcatgccaagcggtcgatcacgctgtcatcgcgacag
agccagacgattgccgcgactgatctgttcggggcgtttttcgatacgacctacacttac
cgtttcggcccgccgtcccatgatgtcacggtggcccggcttcgcgacgttgcgaccgga
caagtcattgctgatgcattccattttccgctcggccggaaaaaggcgctgcacgcggca
aacctccaggtcgccatcagccaaaacaacgatatctggtcgcttgagatcggcactgac
cgtctggcgcagtctgtccatgttgccgcagaaggttaccgcgcttcggaaaactggttc
caccttgcccccggcgagagcagaaagatcagccttgtgccggagaccgcaggatctcag
acgcctccttccggtgacgtggtgtcattggggtccaggcgacgattttccttttag

DBGET integrated database retrieval system